KEGG   Anas platyrhynchos (mallard): 101796218Help
Entry
101796218         CDS       T02816                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101796218
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101796218
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101796218
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101796218
  Exosomal proteins of breast milk
   101796218
Heparan sulfate/heparin binding proteins [BR:apla00536]
 Enzymes (General comment) Variety
  101796218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 468 aa AA seqDB search
CIAEAETNFEGIESKFSLRTPAEPDEDVCYLVPGQMDSLAQCNFNHTSKTFVVIHGWTVX
XMYESWVPKLVDALYKREPDSNVIVVXWLVRAQQHYPVSAAYTKLVGKDVAMFIDWMEEK
VNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAGPTFEYADALTRLSPDDADF
VDVLHTYTXXXXXXXDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIAEKGLADVDQ
LVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRT
KRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFLISLYGTLDESENIAFTLPE
VSSNKTFSFLIYTEVDIGDLLMLKLQWEKDSFFSWSDWWTPFTFSIQRVRVKSGETQKKV
VFCSRDGTSRLGKGEEAAIFVKCLEQPVNRKRGGAKKASKENSAHESA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
tgcatagcagaagctgagacgaattttgagggaatcgagagcaagttttccttacggacg
cctgcagagcccgatgaggatgtctgctacctggttcctgggcagatggacagcctggca
cagtgcaacttcaaccacaccagtaaaacctttgtggtcatccatggatggacggtnnnn
nncatgtatgaaagttgggtcccaaagctggtcgatgctctgtacaagagggaacctgat
tcaaacgtcattgtggtnnactggctagttcgagctcagcagcactacccagtgtctgct
gcgtacactaagctggtgggaaaggatgtcgctatgtttattgactggatggaggagaaa
gtcaattacccactcaacaatgtccacttgctggggtacagtctgggtgctcacgctgct
gggattgctgggagcctgaccaagaagaaggtgaacagaattactgggctggatcctgct
gggcccacctttgagtacgctgatgcccttacgcgcctctccccggatgacgctgacttt
gtggatgtcctacacacctacaccnnnnnnnnnnnnnnnnnnncagatcgcagcattggg
attcagaaacccgttggacacatcgatatttaccctaatgggggaggcttccagccgggc
tgcaacttgggagaagctctgcgtctgattgctgaaaaaggccttgcagatgtggatcag
ctggtgaaatgctctcacgaacgatccatccacctcttcatcgactccctcctctacgaa
gaaaagcccagcatggcctaccgctgcaacacgaaggaggcctttgagaaggggctctgc
ctcagctgccgcaagaaccgctgcaacaacttgggttacaaggtcaacagagtgagaaca
aagagaaacaccaaaatgtacctgaagacccgagctcagatgccctacaaagtcttccat
taccaggtcaagatccatttctttggaaagacaaatatgaccaagaccaaccagccattc
ctgatctctctgtatggcactttagatgagagtgagaacattgctttcacattgccagaa
gtctcctcaaacaagaccttctctttcctgatttacacagaagtggacattggtgacctg
cttatgctaaagttgcagtgggaaaaagacagctttttcagctggtcagactggtggact
ccttttacattcagcatccagagagtcagagtgaagtcaggcgaaactcagaaaaaggtg
gtgttttgttctcgagatggcacctcacgtcttggtaaaggagaagaggcagcaatattt
gtgaaatgcctggagcagcctgtcaacaggaaaaggggaggagccaagaaagcctctaaa
gaaaattctgcacatgaatctgcttaa

DBGET integrated database retrieval system