KEGG   Anas platyrhynchos (mallard): 101796218Help
Entry
101796218         CDS       T02816                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apla00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:apla03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 468 aa AA seqDB search
CIAEAETNFEGIESKFSLRTPAEPDEDVCYLVPGQMDSLAQCNFNHTSKTFVVIHGWTVX
XMYESWVPKLVDALYKREPDSNVIVVXWLVRAQQHYPVSAAYTKLVGKDVAMFIDWMEEK
VNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAGPTFEYADALTRLSPDDADF
VDVLHTYTXXXXXXXDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIAEKGLADVDQ
LVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRT
KRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFLISLYGTLDESENIAFTLPE
VSSNKTFSFLIYTEVDIGDLLMLKLQWEKDSFFSWSDWWTPFTFSIQRVRVKSGETQKKV
VFCSRDGTSRLGKGEEAAIFVKCLEQPVNRKRGGAKKASKENSAHESA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
tgcatagcagaagctgagacgaattttgagggaatcgagagcaagttttccttacggacg
cctgcagagcccgatgaggatgtctgctacctggttcctgggcagatggacagcctggca
cagtgcaacttcaaccacaccagtaaaacctttgtggtcatccatggatggacggtnnnn
nncatgtatgaaagttgggtcccaaagctggtcgatgctctgtacaagagggaacctgat
tcaaacgtcattgtggtnnactggctagttcgagctcagcagcactacccagtgtctgct
gcgtacactaagctggtgggaaaggatgtcgctatgtttattgactggatggaggagaaa
gtcaattacccactcaacaatgtccacttgctggggtacagtctgggtgctcacgctgct
gggattgctgggagcctgaccaagaagaaggtgaacagaattactgggctggatcctgct
gggcccacctttgagtacgctgatgcccttacgcgcctctccccggatgacgctgacttt
gtggatgtcctacacacctacaccnnnnnnnnnnnnnnnnnnncagatcgcagcattggg
attcagaaacccgttggacacatcgatatttaccctaatgggggaggcttccagccgggc
tgcaacttgggagaagctctgcgtctgattgctgaaaaaggccttgcagatgtggatcag
ctggtgaaatgctctcacgaacgatccatccacctcttcatcgactccctcctctacgaa
gaaaagcccagcatggcctaccgctgcaacacgaaggaggcctttgagaaggggctctgc
ctcagctgccgcaagaaccgctgcaacaacttgggttacaaggtcaacagagtgagaaca
aagagaaacaccaaaatgtacctgaagacccgagctcagatgccctacaaagtcttccat
taccaggtcaagatccatttctttggaaagacaaatatgaccaagaccaaccagccattc
ctgatctctctgtatggcactttagatgagagtgagaacattgctttcacattgccagaa
gtctcctcaaacaagaccttctctttcctgatttacacagaagtggacattggtgacctg
cttatgctaaagttgcagtgggaaaaagacagctttttcagctggtcagactggtggact
ccttttacattcagcatccagagagtcagagtgaagtcaggcgaaactcagaaaaaggtg
gtgttttgttctcgagatggcacctcacgtcttggtaaaggagaagaggcagcaatattt
gtgaaatgcctggagcagcctgtcaacaggaaaaggggaggagccaagaaagcctctaaa
gaaaattctgcacatgaatctgcttaa

DBGET integrated database retrieval system