KEGG   Anas platyrhynchos (mallard): 101796417Help
Entry
101796417         CDS       T02816                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:apla00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 725 aa AA seqDB search
MLGFLKNPVVVTAEINVNLVVLTVMGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGALCIPLAY
QILVELQFSHCAALGGALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHS
SFSASWWVWLLLTGVACSCAVGVKYMGLFTYMLLLAIAGLHFWHMLGNQNLSNVSLLCHF
LARGLALIIIPMAMYLSFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNVSMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVLTWASANVAAVIYVCLSLWYLVRRR
RKIYDIPEDAWQLWVSAGEICVGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLIPIVLQ
HLSDYLCRSLLPKTMFRALIVAWFSSVYLVYSTFSPVTYGEPSLSVAELKDLRWKDSWNI
LIRKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttctgaagaacccagttgtggttactgcggagataaatgtgaaccttgtg
gtgctgactgtgatggggttaataagccgtctctgggggctttcctatccccgtgctgtg
gtttttgatgaagtttattatggccagtttgtttccctctacatgaagagaatcttcttc
gtcgatgacagcggcccaccttttggccatatgctgctggctttgggaggttacctagga
ggatttgatggaaacttcttatggaacaggattggagctgaatatagcatgaacgttccc
gtttggtccttgcgactcctgccggcgctggctggtgctctctgtatccctttagcatac
cagatcttggtagaactgcagttctcccactgtgccgcgcttggaggtgctctgctgatt
ctcttagagaactctttgatcactcagtcaaggttcatgctcctggaatccatattgatt
ttttttatcctacttgcggttttgtcctacctgaagttctacaatttgcaaaggcacagt
tccttctctgcaagttggtgggtttggcttctgttgactggagtggcttgttcttgtgca
gttggagtgaaatatatgggcctgtttacctatatgctgctcttggccatcgcaggactc
cacttctggcacatgttaggaaaccagaacttgtcaaacgtttccttactgtgccatttt
ctagctaggggactggccctcatcatcatccccatggcaatgtacctgtccttcttctat
gttcacttgactttgctgtatcgctctgggcctcatgaccagattatgacaagtgctttc
caagccagcttagagggtgggctggctcgaatcactcagggtcagcccttagaggtggcc
tatggctctcagatcactctccggaatgtgttgggcaagcccatgcagtgttggctccat
tctcacacgaatacttaccccatcaggtatgagaatggccgaggcagttcccatcaacag
caggtgacctgctatcccttcaaggatgtgaacaactggtggattgtcaaagatcctgga
atgcagcagctggtggtgagtaacccaccccgtcctgtccggcacggacacatcgtgcag
ctggtccacggcatcacgactcggtacctcaacacgcatgatgttgctgcccctcttagc
ccccactcccaagaagtttcctgctatattgattataacgtctccatgccagcacagaac
ctctggagagtggaaattgtaaatcgggagtctgacacagatgtgtggaagacaattctg
tcagaagtgaggtttgttcatgtgaacacctctgcagtgctaaagctcagtggagcatct
ttacctgagtggggataccggcagctagaggtggttggagagaagctgtccaaaggctac
caccagagcatggtgtggaatgtggaagagcacagatacgggaaaagccaagagcaaaaa
gagagggaagtggaactccactctcccacgcagatggacataagtaaaaacctcagcttc
atggcaaagttcacagaattacagtggaagatactcacgctgaaaaatgaagacacggag
cataagtacagctcctctgctcttgactggatcacaatggatacaaatattgcctactgg
ctacacccaacctctggtgcccagatccatctccttgggaacgttctcacctgggcttca
gctaacgttgctgctgtgatctatgtgtgtctgtccctgtggtacttggtacgacgaagg
agaaaaatttatgacattcctgaagatgcatggcagctgtgggtatcagctggggagatc
tgtgttggaggctgggctgtgaattacctgcccttcttcctgatggagaagacacttttc
ctgtaccactacttgcctgccctcacgttccagattctcctgattcccattgtattacag
catctcagcgattatctctgcagatcgctgcttcccaagaccatgttcagagcactgatc
gtagcctggttctcgtcagtgtacctcgtctacagcacattcagccctgtgacctacggg
gagccctcgctgtctgttgctgaactcaaggacttgcgctggaaggacagctggaacatc
cttatccgaaaacagtaa

DBGET integrated database retrieval system