KEGG   Anas platyrhynchos (mallard): 101796668Help
Entry
101796668         CDS       T02816                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101796668 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    101796668 (UGT2A1)
   00500 Starch and sucrose metabolism
    101796668 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101796668 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101796668 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    101796668 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101796668 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    101796668 (UGT2A1)
   00983 Drug metabolism - other enzymes
    101796668 (UGT2A1)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101796668 (UGT2A1)
Glycosyltransferases [BR:apla01003]
 Others
  Hydrophobic molecule
   101796668 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 700 aa AA seqDB search
MAAKASSSTKCLQLLVFQVALVGPVCCGNVLVWPTEGSHWLNVQAVIRELIRRGHSVTVL
VSNASLFIQPKAEAAERFEIFNVPFQKDTIENLIEGLVALWLNNRPTALTFWQFYKELGK
LSKSWHQLNRQMCDAVLTNQELMAHLRGSGYDLLLSDPVTLCGDLVALKLAVPFVYSLRF
SPASTVERHCGKIPAPPSYTPAALSELTDRMSFSERIKNIVSYHLQDYVFQSYWGEWDVY
YSKILDASHWINIKVLLEELVLRGHEVTVLVPSSNLLINYEDTSSPFTFEVLQVPYSQEF
LNAVMEDFLNLWMNELPNLFPWEVMWRMTELIGSFSDMSKQTCDTLVTNPQLMAKLQQAK
FDVLIADPLAVGGELVAQLLEIPFVYTFRFSDGNVAERLCGGLPSPPSYVPASTVGMTDQ
MSFVERLRNFLFYLYTDLFFLKFWRDEWDGYYSNVLGRPTTLCETMGKAEIWLIRTYWDF
EFPRPFLPNFEFVGGLHCQPAKPLPKVLWRYKGKKPEALGSNTRTYDWIPQNDLLGHPLT
KVFITHGGTNGIYEAIYHGIPLVGIPMFADQHDNIAHMRAKGAAVELDFGTLKTEDLVDA
VNTVINNSSYKENALRLSKIHHDQPITPLDRAVFWIEFVMRHKGAKHLRPAAHHLTWYQY
HCLDVLAFLFTCAAIAVFILVKCCLFCCRKRGRIAKRKKE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaaagccagcagctccacgaagtgcctccagctgcttgttttccaggtggct
cttgtagggcctgtctgctgtgggaacgtgctggtctggccaacagaaggcagccactgg
ctaaacgtgcaggcggtcatacgggagctcatccgccgcgggcacagcgtcaccgtcctg
gtatccaacgcctccctcttcattcagcccaaggctgaggccgcggagaggtttgagatc
tttaacgtgcccttccagaaagacaccatcgagaacctgatcgaggggctcgtggcactg
tggctgaacaacaggccgacagccctgaccttctggcagttttataaggagctgggaaaa
ctgtccaaaagctggcaccagctcaacaggcagatgtgcgatgcggtgctaaccaaccag
gagctgatggcccacctgcggggctctggctacgacctgctgctctccgacccggtgacc
ctctgcggggacctcgtggctctcaagctggctgtccccttcgtgtactcgctgcgcttc
tccccagcttccaccgtggagaggcactgtggcaagatcccagccccgccgtcctacacg
cctgcagccctgtccgagctcaccgaccgcatgtccttcagcgagagaataaaaaatatc
gtgtcttaccacttgcaagactacgttttccagagctactggggagagtgggacgtctac
tacagcaagatcctcgacgcaagtcactggatcaacatcaaagtgctgctggaagagctc
gtcctccggggtcatgaggtgactgtgctggtgccatcaagcaatctgctcatcaactat
gaagacacctcttcccctttcacttttgaggtcctgcaagtgccctattcccaggagttc
ctgaatgctgtcatggaggacttcctcaacctctggatgaatgaacttcctaatctgttt
ccctgggaggtcatgtggaggatgacagagctcataggctccttttctgacatgtcaaag
cagacctgtgacactttggtgacgaaccctcagctgatggcaaagctgcagcaggccaag
tttgatgttctgatcgctgaccctctggctgtagggggggagcttgtagcacaactactg
gaaatcccttttgtctataccttccgcttctctgacgggaacgtggcagagaggctgtgt
ggtgggctcccgtccccaccttcttatgtgcctgctagcacagtggggatgacggaccag
atgtcctttgtggagagactgcggaacttcctcttttacctttacacggatttatttttc
ttgaagttttggcgagatgaatgggatgggtactacagtaatgtcttaggaaggcccacg
accctgtgtgagacgatggggaaagcagagatctggttaatcagaacgtactgggatttt
gaatttccacgccctttcctgcccaactttgagtttgttggaggacttcattgccagcct
gcaaagccgttgccaaaggtcctttggaggtacaaaggaaagaaaccagaagctctgggc
tccaacaccaggacttatgactggataccccaaaatgacctgcttggccatcccttgacg
aaagtcttcattactcacggtggcaccaatgggatctatgaagctatctaccacgggatc
ccgttggttgggattcccatgtttgctgaccagcatgacaacattgcgcacatgagggca
aagggagctgcagttgagctggattttggcacgctgaagacagaggacctagttgatgca
gtgaatacagtcattaacaattcctcctacaaggaaaatgctttaagattatccaagata
caccacgaccagccaattacgcctctggacagagctgtcttctggattgaatttgtcatg
cgtcacaaaggagcaaagcacttgagacctgccgctcaccatctcacctggtaccagtac
cactgcctggatgttctggcattcttgttcacctgtgcagccattgctgtcttcattctt
gtcaagtgctgcctattttgctgtaggaaacgtggtagaattgcaaaaagaaagaaagaa
tag

DBGET integrated database retrieval system