KEGG   Anas platyrhynchos (mallard): 101797205Help
Entry
101797205         CDS       T02816                                 

Definition
uncharacterized LOC101797205
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101797205
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101797205
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101797205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 240 aa AA seqDB search
MLWPKLQISLQYDIAVTVINEDVEPRQYLMSGQTAQVKLKNVVPHDIGDPDDEPWQRVNA
YLIHDTANWKDLNLKFVLQVYRDYYLTCGGGERRMGWRLLECNKGAARAAAVTQRLGRSG
AAESLAMGYFRAAGKRQTLLLEAQSSPPGGGAGQALRFLPSSPEAAVCEAVCVASVADLS
QTFLTFTRGESFKPLVPACQIRRATGRVMVQPQGRAVPARFNLWLGPRSCIAAWQRSCRD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcccaagctgcagatcagcctgcagtacgacatcgccgtcacggtgataaac
gaggacgtggagccccggcagtacctgatgagcggccagacggcacaggtgaagctgaaa
aatgtggtgccccacgacatcggggacccagacgacgagccctggcagcgcgtcaacgcc
tacctgatccacgacacggccaactggaaggacctgaacctgaagttcgtgctgcaggtg
tatcgcgactactacctgacctgtggtggtggtgagaggagaatgggctggagactgctc
gaatgcaacaagggggcagcgagagcagcagcagtaacgcagcgcctgggacgcagcggg
gcagcagagagccttgctatgggttatttccgagcagcagggaagagacagaccctgctg
ctggaagctcagagcagcccgccgggtgggggtgcggggcaggctctgcgtttcctcccc
tcttctccagaagcggctgtttgtgaggctgtttgtgtagcgagcgtggctgacctttca
cagacctttttaacttttactaggggtgaaagtttcaagcctctcgtgccagcgtgccag
atccggcgagccacaggacgtgtcatggtccagcctcagggccgtgctgtccctgctcgc
ttcaacctttggctggggccgcggtcctgcatcgctgcctggcagcgcagctgcagggat
tga

DBGET integrated database retrieval system