KEGG   Anas platyrhynchos (mallard): 101797377Help
Entry
101797377         CDS       T02816                                 

Definition
glutamate dehydrogenase 1, mitochondrial-like
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:apla00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:apla00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apla00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:apla00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MSIISLLKTALSYLSACLPLKEHSLLLQGIRYSLDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFG
DKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGEFNGSIWNPDGIDPKELEDYKLQHGTIMG
FPKAQILEGSILETDCDILIPAASEKQLTKANAHKVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPVVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGLTFT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagtattataagcctcctaaaaactgctctgagttacctatcggcttgtcttcctctg
aaggaacattcacttttgctccaaggtattcgttatagtttggatgtcagtgtggatgaa
gtgaaagccttagcatctctaatgacatataaatgtgctgttgttgatgtgccatttggt
ggggcaaaggctggtgtcaagatcaatcccaagaactacacagacaatgagttggaaaaa
atcacaagaaggtttaccatggagctggcaaaaaagggtttcattggtcctggagttgat
gtgcctgctcctgacatgagcacaggggaaagggagatgtcctggattgctgacacctat
gccagtacaataggacactatgatattaacgcacatgcatgtgtaactggcaaacccatc
agccagggtgggatccacgggcgtatatctgcaaccggtcgtggtctcttccacgggatt
gaaaatttcatcaatgaggcatcgtatatgagtatattaggaatgactccgggatttggg
gataaaacatttgctgttcagggatttggtaacgtgggcttgcattctatgagatacctg
catcggtttggagcaaaatgtgttgctgttggagaatttaatggttccatctggaatcct
gatgggattgacccaaaggaactagaagattacaaattgcaacatgggacaatcatgggc
ttccctaaagcacagatactggagggcagtattctggaaacagactgtgacattctcatc
cctgctgccagcgaaaagcagttgactaaggccaatgctcacaaggtcaaagcaaaaatt
attgctgagggtgccaatgggcctacgactcctgaagctgacaaaatcttcttggagagg
aatatcatggttattcctgatctttacctgaatgcaggtggggtaacagtatcctatttt
gagtggctgaaaaacttgaaccatgtcagctatggtcgcctgacttttaaatatgaaagg
gattcaaactaccacttgctcatgtctgtccaggaaagcttggagagaaaatttgggaaa
catggtggaactataccagttgtgcctacagcagaatttcaggataggatatcaggtgca
tctgagaaggacattgtccactctgggctggcttatacaatggagcgttctgctcggcaa
atcatgcggactgccatgaagtacaacttgggtctggacctgagaacagctgcctatgtc
aatgcaattgagaaagtcttcaaagtctacaatgaggctggcctgacctttacataa

DBGET integrated database retrieval system