KEGG   Anas platyrhynchos (mallard): 101797377Help
Entry
101797377         CDS       T02816                                 

Definition
(RefSeq) glutamate dehydrogenase 1, mitochondrial-like
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101797377
  Energy metabolism
   00910 Nitrogen metabolism
    101797377
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101797377
   00330 Arginine and proline metabolism
    101797377
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101797377
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101797377
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101797377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MSIISLLKTALSYLSACLPLKEHSLLLQGIRYSLDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFG
DKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGEFNGSIWNPDGIDPKELEDYKLQHGTIMG
FPKAQILEGSILETDCDILIPAASEKQLTKANAHKVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPVVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGLTFT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagtattataagcctcctaaaaactgctctgagttacctatcggcttgtcttcctctg
aaggaacattcacttttgctccaaggtattcgttatagtttggatgtcagtgtggatgaa
gtgaaagccttagcatctctaatgacatataaatgtgctgttgttgatgtgccatttggt
ggggcaaaggctggtgtcaagatcaatcccaagaactacacagacaatgagttggaaaaa
atcacaagaaggtttaccatggagctggcaaaaaagggtttcattggtcctggagttgat
gtgcctgctcctgacatgagcacaggggaaagggagatgtcctggattgctgacacctat
gccagtacaataggacactatgatattaacgcacatgcatgtgtaactggcaaacccatc
agccagggtgggatccacgggcgtatatctgcaaccggtcgtggtctcttccacgggatt
gaaaatttcatcaatgaggcatcgtatatgagtatattaggaatgactccgggatttggg
gataaaacatttgctgttcagggatttggtaacgtgggcttgcattctatgagatacctg
catcggtttggagcaaaatgtgttgctgttggagaatttaatggttccatctggaatcct
gatgggattgacccaaaggaactagaagattacaaattgcaacatgggacaatcatgggc
ttccctaaagcacagatactggagggcagtattctggaaacagactgtgacattctcatc
cctgctgccagcgaaaagcagttgactaaggccaatgctcacaaggtcaaagcaaaaatt
attgctgagggtgccaatgggcctacgactcctgaagctgacaaaatcttcttggagagg
aatatcatggttattcctgatctttacctgaatgcaggtggggtaacagtatcctatttt
gagtggctgaaaaacttgaaccatgtcagctatggtcgcctgacttttaaatatgaaagg
gattcaaactaccacttgctcatgtctgtccaggaaagcttggagagaaaatttgggaaa
catggtggaactataccagttgtgcctacagcagaatttcaggataggatatcaggtgca
tctgagaaggacattgtccactctgggctggcttatacaatggagcgttctgctcggcaa
atcatgcggactgccatgaagtacaacttgggtctggacctgagaacagctgcctatgtc
aatgcaattgagaaagtcttcaaagtctacaatgaggctggcctgacctttacataa

DBGET integrated database retrieval system