KEGG   Anas platyrhynchos (mallard): 101797377Help
Entry
101797377         CDS       T02816                                 

Gene name
GLUD1
Definition
(RefSeq) glutamate dehydrogenase 1
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101797377 (GLUD1)
  Energy metabolism
   00910 Nitrogen metabolism
    101797377 (GLUD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101797377 (GLUD1)
   00220 Arginine biosynthesis
    101797377 (GLUD1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101797377 (GLUD1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101797377 (GLUD1)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101797377 (GLUD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 417 aa AA seqDB search
MLILTCTGIRYSLDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKI
TRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPIS
QGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFGDKTFAVQGFGNVGLHSMRYLH
RFGAKCVAVGEFNGSIWNPDGIDPKELEDYKLQHGTIMGFPKAQILEGSILETDCDILIP
AASEKQLTKANAHKVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFE
WLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPVVPTAEFQDRISGAS
EKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGLTFT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttgattttaacatgcacaggtattcgttatagtttggatgtcagtgtggatgaagtg
aaagccttagcatctctaatgacatataaatgtgctgttgttgatgtgccatttggtggg
gcaaaggctggtgtcaagatcaatcccaagaactacacagacaatgagttggaaaaaatc
acaagaaggtttaccatggagctggcaaaaaagggtttcattggtcctggagttgatgtg
cctgctcctgacatgagcacaggggaaagggagatgtcctggattgctgacacctatgcc
agtacaataggacactatgatattaacgcacatgcatgtgtaactggcaaacccatcagc
cagggtgggatccacgggcgtatatctgcaaccggtcgtggtctcttccacgggattgaa
aatttcatcaatgaggcatcgtatatgagtatattaggaatgactccgggatttggggat
aaaacatttgctgttcagggatttggtaacgtgggcttgcattctatgagatacctgcat
cggtttggagcaaaatgtgttgctgttggagaatttaatggttccatctggaatcctgat
gggattgacccaaaggaactagaagattacaaattgcaacatgggacaatcatgggcttc
cctaaagcacagatactggagggcagtattctggaaacagactgtgacattctcatccct
gctgccagcgaaaagcagttgactaaggccaatgctcacaaggtcaaagcaaaaattatt
gctgagggtgccaatgggcctacgactcctgaagctgacaaaatcttcttggagaggaat
atcatggttattcctgatctttacctgaatgcaggtggggtaacagtatcctattttgag
tggctgaaaaacttgaaccatgtcagctatggtcgcctgacttttaaatatgaaagggat
tcaaactaccacttgctcatgtctgtccaggaaagcttggagagaaaatttgggaaacat
ggtggaactataccagttgtgcctacagcagaatttcaggataggatatcaggtgcatct
gagaaggacattgtccactctgggctggcttatacaatggagcgttctgctcggcaaatc
atgcggactgccatgaagtacaacttgggtctggacctgagaacagctgcctatgtcaat
gcaattgagaaagtcttcaaagtctacaatgaggctggcctgacctttacataa

DBGET integrated database retrieval system