KEGG   Anas platyrhynchos (mallard): 101797377Help
Entry
101797377         CDS       T02816                                 

Definition
glutamate dehydrogenase 1, mitochondrial-like
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101797377
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101797377
   00330 Arginine and proline metabolism
    101797377
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101797377
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101797377
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101797377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MSIISLLKTALSYLSACLPLKEHSLLLQGIRYSLDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFG
DKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGEFNGSIWNPDGIDPKELEDYKLQHGTIMG
FPKAQILEGSILETDCDILIPAASEKQLTKANAHKVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPVVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGLTFT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagtattataagcctcctaaaaactgctctgagttacctatcggcttgtcttcctctg
aaggaacattcacttttgctccaaggtattcgttatagtttggatgtcagtgtggatgaa
gtgaaagccttagcatctctaatgacatataaatgtgctgttgttgatgtgccatttggt
ggggcaaaggctggtgtcaagatcaatcccaagaactacacagacaatgagttggaaaaa
atcacaagaaggtttaccatggagctggcaaaaaagggtttcattggtcctggagttgat
gtgcctgctcctgacatgagcacaggggaaagggagatgtcctggattgctgacacctat
gccagtacaataggacactatgatattaacgcacatgcatgtgtaactggcaaacccatc
agccagggtgggatccacgggcgtatatctgcaaccggtcgtggtctcttccacgggatt
gaaaatttcatcaatgaggcatcgtatatgagtatattaggaatgactccgggatttggg
gataaaacatttgctgttcagggatttggtaacgtgggcttgcattctatgagatacctg
catcggtttggagcaaaatgtgttgctgttggagaatttaatggttccatctggaatcct
gatgggattgacccaaaggaactagaagattacaaattgcaacatgggacaatcatgggc
ttccctaaagcacagatactggagggcagtattctggaaacagactgtgacattctcatc
cctgctgccagcgaaaagcagttgactaaggccaatgctcacaaggtcaaagcaaaaatt
attgctgagggtgccaatgggcctacgactcctgaagctgacaaaatcttcttggagagg
aatatcatggttattcctgatctttacctgaatgcaggtggggtaacagtatcctatttt
gagtggctgaaaaacttgaaccatgtcagctatggtcgcctgacttttaaatatgaaagg
gattcaaactaccacttgctcatgtctgtccaggaaagcttggagagaaaatttgggaaa
catggtggaactataccagttgtgcctacagcagaatttcaggataggatatcaggtgca
tctgagaaggacattgtccactctgggctggcttatacaatggagcgttctgctcggcaa
atcatgcggactgccatgaagtacaacttgggtctggacctgagaacagctgcctatgtc
aatgcaattgagaaagtcttcaaagtctacaatgaggctggcctgacctttacataa

DBGET integrated database retrieval system