KEGG   Anas platyrhynchos (mallard): 101797377Help
Entry
101797377         CDS       T02816                                 

Gene name
GLUD1
Definition
(RefSeq) glutamate dehydrogenase 1
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00220  Arginine biosynthesis
apla00250  Alanine, aspartate and glutamate metabolism
apla00471  D-Glutamine and D-glutamate metabolism
apla00910  Nitrogen metabolism
apla01100  Metabolic pathways
apla01200  Carbon metabolism
apla04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101797377 (GLUD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101797377 (GLUD1)
   00220 Arginine biosynthesis
    101797377 (GLUD1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101797377 (GLUD1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    101797377 (GLUD1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101797377 (GLUD1)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101797377 (GLUD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 101797377
NCBI-ProteinID: XP_005026301
Position
Un
AA seq 417 aa AA seqDB search
MLILTCTGIRYSLDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKI
TRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPIS
QGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFGDKTFAVQGFGNVGLHSMRYLH
RFGAKCVAVGEFNGSIWNPDGIDPKELEDYKLQHGTIMGFPKAQILEGSILETDCDILIP
AASEKQLTKANAHKVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFE
WLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPVVPTAEFQDRISGAS
EKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGLTFT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttgattttaacatgcacaggtattcgttatagtttggatgtcagtgtggatgaagtg
aaagccttagcatctctaatgacatataaatgtgctgttgttgatgtgccatttggtggg
gcaaaggctggtgtcaagatcaatcccaagaactacacagacaatgagttggaaaaaatc
acaagaaggtttaccatggagctggcaaaaaagggtttcattggtcctggagttgatgtg
cctgctcctgacatgagcacaggggaaagggagatgtcctggattgctgacacctatgcc
agtacaataggacactatgatattaacgcacatgcatgtgtaactggcaaacccatcagc
cagggtgggatccacgggcgtatatctgcaaccggtcgtggtctcttccacgggattgaa
aatttcatcaatgaggcatcgtatatgagtatattaggaatgactccgggatttggggat
aaaacatttgctgttcagggatttggtaacgtgggcttgcattctatgagatacctgcat
cggtttggagcaaaatgtgttgctgttggagaatttaatggttccatctggaatcctgat
gggattgacccaaaggaactagaagattacaaattgcaacatgggacaatcatgggcttc
cctaaagcacagatactggagggcagtattctggaaacagactgtgacattctcatccct
gctgccagcgaaaagcagttgactaaggccaatgctcacaaggtcaaagcaaaaattatt
gctgagggtgccaatgggcctacgactcctgaagctgacaaaatcttcttggagaggaat
atcatggttattcctgatctttacctgaatgcaggtggggtaacagtatcctattttgag
tggctgaaaaacttgaaccatgtcagctatggtcgcctgacttttaaatatgaaagggat
tcaaactaccacttgctcatgtctgtccaggaaagcttggagagaaaatttgggaaacat
ggtggaactataccagttgtgcctacagcagaatttcaggataggatatcaggtgcatct
gagaaggacattgtccactctgggctggcttatacaatggagcgttctgctcggcaaatc
atgcggactgccatgaagtacaacttgggtctggacctgagaacagctgcctatgtcaat
gcaattgagaaagtcttcaaagtctacaatgaggctggcctgacctttacataa

DBGET integrated database retrieval system