KEGG   Anas platyrhynchos (mallard): 101798246Help
Entry
101798246         CDS       T02816                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101798246 (RBKS)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101798246 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 323 aa AA seqDB search
MLPSLVPSQPSNIHLEPGEKAGRFFTAVLPNLTTRLPKAGETVLGQKFFIGFGGKGANQC
VQSARLGAKTSLICKVGNDSFGNDYVENLKKNGVSTAFVGQTTEAATGTASIIVNSEGQN
VIVIVPGANLLLNSEDLKRASDVICKAKVVVCQLEISPAVSLEALKMARASGVKTLFNPA
PALADLDPQFYTHSDVFCCNETEAEILTGIPVGNLEDAGKVGRMLLERGCKLVVVTLGAE
GCVMISVEEPIPKHVPAGKVRAVDTTGAGDSFVGALAFYLAYYPKLPMEEMVRKCNCIAS
VSVQAAGTQSSYPYRKDLPQDLF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctgccatccctggttccttcccagcccagtaacatccacctggagcctggagaaaaa
gcaggaagatttttcaccgctgtgttgcctaaccttaccacgcgattgccaaaagctgga
gaaactgtcctcggacagaagtttttcattggttttggtgggaaaggagccaatcaatgc
gtccagtctgctcgactcggggccaagacctcgctgatctgcaaggttggaaatgattcc
tttggcaatgattacgttgaaaatttgaagaagaatggtgtttctacagcatttgtaggt
cagactacagaagctgctactggaactgcttcaataattgtcaacagcgaagggcagaat
gttattgtcatagtcccaggagccaatctgcttttaaattctgaagacctgaagagagct
tccgatgtcatctgtaaagccaaagtggttgtctgccagctagaaatatcccctgctgtt
tctcttgaagcactgaaaatggcacgtgccagtggagtaaagactttatttaatccagct
ccagcccttgctgacctagatccacaattctatactcattctgacgtcttctgctgcaat
gaaactgaggcagaaattttaacgggcatcccagttggcaaccttgaagatgctggaaag
gtgggacgcatgctgttagaaagagggtgtaagcttgtagttgttactcttggagcagaa
ggctgcgtgatgatatcagtagaagaacccattccaaagcacgttcctgctgggaaggtc
agagctgtggacactacgggagctggagacagttttgtgggagcactcgccttctacctg
gcttactatcccaagctacccatggaggaaatggtcaggaagtgtaactgcattgcctcg
gtgagcgtccaggcagcggggacacaatcttcgtatccttacaggaaggacttgcctcag
gaccttttctga

DBGET integrated database retrieval system