KEGG   Anas platyrhynchos (mallard): 101799480Help
Entry
101799480         CDS       T02816                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101799480 (UCHL1)
Peptidases [BR:apla01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101799480 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 212 aa AA seqDB search
MLNKVLARLGVSPGWRFVDVLGFEEEALGAVPSPACEMFEMITCLQHENFRKQQTEKIKD
QEISSKVYFLKQTVSNSCGTIGLIHAVANNKDKVKLDEGSALKKFLDETADLSPEERAKH
FASNKAIQEVHNSVAQEGQCRVDDNSVNFHFILFANVDGHLYELDGRMPFPVNHGTSSDD
LLLKDSAKICRQFTEREKGEVRFSAVAFCKSA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacaaagtgctggcccgcctgggtgtgagccccggctggcgcttcgtggacgtg
ctgggcttcgaggaggaggcgctgggcgccgtgcccagcccggcctgtgaaatgtttgaa
atgattacgtgtttacagcatgagaacttcaggaaacaacagactgagaaaataaaggac
caagaaatcagttccaaggtgtatttcctgaagcagactgtcagtaactcgtgtgggaca
attggtctgatacacgcagttgctaataacaaagacaaggtgaaacttgatgaggggtct
gccctgaagaaattcctcgatgaaacagctgatctctctcctgaagagagagccaagcac
tttgcaagtaataaggctatacaagaagtccacaactctgttgcacaggaaggacagtgt
cgggttgatgacaacagcgtgaacttccacttcatcctgtttgccaatgtggatggacat
ctgtatgagctggatgggcgcatgccatttcctgtgaaccatggcacaagctcagatgac
ttgctcttgaaggattctgctaagatctgcaggcaatttacagaacgtgagaaaggagaa
gttcgtttttctgctgtggctttctgcaagtctgcctga

DBGET integrated database retrieval system