KEGG   Anas platyrhynchos (mallard): 101800809Help
Entry
101800809         CDS       T02816                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:apla00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101800809 (CREBBP)
   04330 Notch signaling pathway
    101800809 (CREBBP)
   04350 TGF-beta signaling pathway
    101800809 (CREBBP)
   04630 Jak-STAT signaling pathway
    101800809 (CREBBP)
   04068 FoxO signaling pathway
    101800809 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101800809 (CREBBP)
  Cell communication
   04520 Adherens junction
    101800809 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101800809 (CREBBP)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101800809 (CREBBP)
   05168 Herpes simplex infection
    101800809 (CREBBP)
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101800809 (CREBBP)
Transcription factors [BR:apla03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101800809 (CREBBP)
Mitochondrial biogenesis [BR:apla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101800809 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2302 aa AA seqDB search
MGKSPLNQGDSSASGLAKQVASTSGPTTPASQTLNSQAQKQVGMVTSSPATSQTGPGICM
NTNFSQTHQSLLNSNSGHSLMNQPQQGQGQMAGHTGLNTAQTGAMTKMGMTGNTSPFGQP
FSQTGGQQMGATGVNPQLPTKPGMANSLSAFPTDIKSTPVTSVPNMSQMQTQVQQVGIVP
TQAMATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMT
HCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGMQNS
IGSVGTGQQNNPSLSNPNPIDPSSMQRAYAALGLPYGNQPQTQLQPQVQGQQAAQPQAHQ
QMRTINALGANQMNLPTGGITTDQQASLISETALPTSLGTNNPLMNDGTNTGNVGNLSSM
PTAAPPSSTGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVE
GDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALQTPGPQPPGIPQ
VAAAMGQAQPVRPPNGPMSMPTVPISRMQVSQGMNQFNPMSIGNVQMPQAPMGPRAASPM
NHPVQMNNMGAVPAMAMSPSRMPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPAPGGAMN
VNNVGMGQSTAQAGVAQQGQVPSAALPNSMNMLGPQSGQLCPPVTQPPLHQTTPPVSTAA
GMPPIQHQTPTGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQA
QVTPQPQTPVQPQSVPTPQPPQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTN
SQQLGPDAPMLESKSEVKTEETEPETSETQVEAKTEVEEDLQGSSQTKEETDGTELKQEP
MEIEEKKPEIKVDVKEEEESGTNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQD
PESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAW
LYNRKTSRVYKFCTKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDA
AYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKE
CGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKF
LRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGV
DVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLG
YVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQ
ATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNA
KKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINT
LPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVY
TCNECKHHVETRWHCTVCEDYDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQ
ESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIAL
CCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSP
TSATPGTPTQQPSTPQTPQPPPQPQPSPVSMSPAGFPSVSRTQPPTTVSAGKPTNPVSAP
PPPAQPPPAAVEAARQIEREAAQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVNQMQQVS
MNVPRPNPVSGPVMSNMQPGQWQSPPMPQQQPMQPGMARPVMPMATPQAVAGPRMPGVQQ
PPRSIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQP
QAGIQPQPGMQQPQTGMQQPGMHTQPGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQAI
NIMNPGHNPSMANMSPQYREILRRQLLQQQQQQQQQQQGGAGMAGGMAGHSQFQQPQGPG
GYPQAMQQQRMQQHISIQGGSMGQMAQMGQLNQMGQPGMGADGTPNIQQALQQRILQQQQ
MKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPH
SSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSAL
SNELSLVGDTTGDTLEKFVEGL
NT seq 6909 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagagccctttgaaccagggagactcgtctgcttcaggcctggcaaagcaagta
gccagcacctctggacctaccacacctgcatcacaaacactgaactctcaagcacaaaaa
caagtggggatggtgacgagcagccctgcaacatcacagactggacctggaatatgtatg
aatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcacagttta
atgaatcagcctcagcaaggacaagggcagatggctggtcacaccggactgaacacagca
cagacaggagcaatgacaaaaatgggaatgacaggtaacactagtccctttgggcaacct
ttcagtcaaactggagggcagcagatgggagctacaggagtgaatcctcagttaccaacc
aagccaggcatggcgaacagtttgtctgccttccctactgacatcaagagtactccggtc
accagtgtgcccaatatgtcccagatgcaaacccaagtacagcaagtggggattgtacca
acgcaggcgatggcaactggaccaacagcagatccggagaagcgcaaactgatccagcag
caattggttttgctgcttcatgctcacaaatgtcagaggcgtgagcaggcaaacggggag
gtgcgagcctgtgctctcccacactgtcgaaccatgaagaatgtcctcaaccacatgaca
cactgtcaagctgggaaggcctgtcaagttgctcattgtgcttcttcgagacaaatcatt
tcccactggaagaattgtactcggcacgactgtcctgtgtgccttcctttgaaaaacgcc
agtgacaagagaaaccaacagccccttttagggtctccagctggtggaatgcagaattcc
atcggttctgttggaacaggccagcagaataatccatcgctaagtaatcctaatccgatt
gaccccagctccatgcaacgagcctacgctgctcttggactcccatatggcaaccagccc
caaacacagttgcagccccaggtacaaggccaacaagcggcacagcctcaggctcaccag
caaatgaggaccattaatgctttgggagccaaccagatgaaccttcccacaggaggaata
acaacagaccagcaagctagtctaatttctgaaactgctcttccaacatcccttgggaca
aataacccactaatgaatgatggcacaaatactggcaatgttggaaacctcagctcaatg
ccaacggctgcacctccttctagtaccggggtaaggaaagcatggcatgaacatgtcact
caggacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccactcctgat
ccagcagcactgaaggatcgccgcatggagaacttggtggcttatgcaaggaaagttgaa
ggagatatgtatgaatctgccaacagtagggatgaatactatcacttattagcggagaaa
atctataagatacaaaaggagctggaagagaagcggaggtctcgtctacataaacaaggg
atcttgggaaatcagccagccttacagacaccgggacctcagccccctggcatcccacag
gttgctgctgccatgggccaggcacagcccgtgaggcctcccaatgggcctatgtccatg
ccaaccgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagtttaaccccatg
tccatagggaatgtacagatgccacaagcacccatgggaccccgtgcagcttctccaatg
aaccatcctgtacaaatgaacaacatgggcgctgttcctgcgatggcaatgtctccttcc
cgaatgcctcagccacagaacatgatgggagctcattccaacaacatgatgggtcaggct
cctacccagaaccaatttctgccccagaatcagtttccagcacctggtggggcaatgaat
gtgaacaatgtaggcatgggtcagtcaacagcccaggcaggggtggcacagcaggggcag
gttcccagtgctgctcttcccaactccatgaacatgctaggaccacagagtggtcagcta
tgtccaccagtgacccagccacctctacatcagactacgccacctgtgtccactgctgct
gggatgccacctattcagcaccaaacaccaactggaatgactcctcctcaaccagcagca
cccactcagccatcaacaccagtctcatcttcaggacaaacccctacaccgaccccgggt
tctgttccaaacgcaacacagacacaaagcacacctacagggcagactgcagcacaggct
caagttaccccgcagcctcagaccccagttcagccccagtctgtgccaaccccgcagcca
ccccagcagcagccaacatctgtgcaggcacagccacctggcactccactatcccaggca
gcagctagtattgataacagggtccccacccctgcctcagttgctagtgctgatacgaat
tcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaaactgaa
gaaactgagccagagactagtgagacacaagtggaagctaagactgaggtggaggaggat
ttacaaggatcttcacaaacaaaagaagaaacagatggaacagaactgaaacaagagcca
atggaaatagaagaaaagaagcctgaaataaaagtagatgttaaggaggaagaggaaagt
ggcactaatggaaccacttcacaatccacatcaccatctcagccccgcaaaaaaattttc
aaacctgaggagctgcgccaggctctcatgcctacccttgaagctttgtaccggcaggac
ccagagtctctacctttcagacagcctgtggatccccagcttttagggattccggactac
tttgacattgtgaagaatcctatggacctttcaaccattaaacgtaaattagatactggg
cagtaccaagaaccgtggcagtatgtggatgatgtttggctaatgtttaacaacgcctgg
ctttacaatcgcaagacttccagggtctataagttttgcactaaactcgcggaggtgttt
gaacaagaaattgatcctgttatgcaatcacttggctactgttgtgggcgcaagtatgag
ttttctccacagaccttgtgctgctatggcaagcagttgtgtactattcctcgtgatgct
gcctactacagttaccagaataggtatcacttctgtgagaagtgtttcactgaaatccag
ggggagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatctctaaagat
cagtttgagaagaagaaaaatgacacactagatcctgagccgtttgttgactgcaaagaa
tgtggtcggaagatgcaccagatttgtgtattacattatgatattatttggccttcaggg
tttgtttgtgacaattgtctgaagaaaactggtagaacacgtaaagaaaacaaattcagt
gctaaaaggctacagactactcgtttaggaaatcatttggaagatagagtaaacaagttt
ttgcgacgacagaatcatcctgaagctggagaggtctttgtccgagtggtggcaagttca
gataagacagtagaggttaaaccaggaatgaaatccagatttgtggattctggtgagatg
tcagaatccttcccttaccgtaccaaagctctatttgcatttgaggagattgacggagta
gatgtatgcttctttggaatgcatgtacaggagtatggctcagattgtccccctccaaat
acaagacgtgtgtacatatcgtatctagatagtattcatttcttccgcccccgttgtctc
cgaactgcagtttatcatgaaatcctcattggatatttggagtacgtgaagaaactgggg
tatgtgacaggacacatctgggcctgtcctccaagtgaaggagatgactacatttttcat
tgccatccacctgatcagaaaatacccaaacccaaacgcttacaagaatggtataagaag
atgctggacaaggcatttgctgagagaatcattcatgactacaaggacatcttcaaacaa
gcgactgaggacaggctgacaagtgccaaggagctgccgtactttgaaggtgatttctgg
cccaatgtgctggaggaaagcattaaagagttggagcaggaggaggaggaaaggaagaag
gaagaaagcactgcagctagtgaaacaacagagggaagccaaggtgacagcaaaaatgcc
aagaaaaagaacaacaaaaaaaccaacaagaataagagtagcatcagcagagctaacaag
aagaaacccagcatgccaaatgtgtccaacgatctgtctcagaagctgtatgccaccatg
gagaagcataaagaggtcttttttgtgattcatttacatgccgggcctgtaattaacact
ctgcctcccattgtggaccctgatccattactgagctgtgatctgatggatgggcgagat
gccttcctcactttagccagagataagcactgggagttctcctcactacgccgatccaag
tggtccacgctctgcatgctggtagaactacatactcaagggcaggatcgctttgtctac
acgtgcaatgagtgcaaacatcatgtggaaacaaggtggcattgcactgtctgtgaggac
tacgacctctgcattaactgctacaacactaagagccatgaccacaagatggttaagtgg
ggcctgggtctggatgatgagagcaacagccaaggagagcagcagtccaagagcccccag
gagtcacgacgactgagcatccagcgctgcattcagtcccttgtccacgcctgtcagtgc
cgcaatgcaaactgctcattgccatcctgccagaagatgaaacgggttgtccagcacacc
aagggttgcaagcgcaagaccaacggtggctgtccagtgtgcaaacagctcatagctctt
tgctgctaccatgccaaacactgccaagagaacaaatgccctgtgccattctgtctcaat
atcaaacacaagcttcgacagcagcagatccagcatcgcctgcagcaggctcagctcatg
cgcagaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttgccttctcct
acctcagcaacgcctggtacccctacacagcagccaagtacaccgcaaacaccgcagcct
cctccccagccccagccttcccctgtaagtatgtcaccggctggcttccccagtgtgtcg
agaactcagccccccactactgtttcagcaggaaaacccacaaacccggtttccgcacct
ccacctccggcccagcctccgccagccgcggtggaagcagctcggcagatcgagagagaa
gctgcccagcagcagcagcaactctacagggtcaacaacatcaacaatggtttgcctcct
ggtcgcccagggctagtaaacccgacggtgggttcagtgaaccagatgcagcaagtcagc
atgaatgtaccccggcccaaccccgtaagcggcccggtgatgtccaacatgcagcctggg
cagtggcagtcgcctccgatgccgcagcagcagccgatgcagccaggaatggcaagacca
gtgatgccaatggcaacgccacaagcagtggctgggcccaggatgccaggcgtgcaacag
ccgccccggagcatccctccgaacgcacttcaggacttactgaggaccttgaaatcaccg
agttcaccgcagcaacagcagcaggttcttaatatccttaaatccaaccctcagcttatg
gcagcttttataaagcaaagaacagccaaatacgtggctaaccagcccgggatgcagccg
caagcaggcatacagccccagcctgggatgcagcagccgcagaccggcatgcaacagcca
ggcatgcacactcaaccgggattgcagaacatgaacgcgatgcaagcgggagtgcagaga
ccgagcgttcctccccagcagcaagggattggagctatgaatccccagggacaagcgata
aacattatgaaccccggccacaaccccagcatggcaaacatgagtccgcagtacagagag
atactgaggaggcaattactgcagcagcagcagcagcaacagcagcagcagcaaggaggg
gctggcatggcaggagggatggcaggacatagccagttccagcagcctcaaggaccggga
ggttaccctcaggccatgcagcagcagcggatgcagcagcatatatccatacaggggggg
tccatgggacagatggctcagatgggacagctgaaccagatgggccagcccggcatgggg
gcagacggcactcccaacattcagcaagcactgcagcagaggatcctgcagcagcagcag
atgaagcagcagatagggtccccgggccagcccaaccccatgagcccacagcagcacatg
ctctcaggacaaccgcaggcgtctcatctccctggccagcagatcgccacctccctcagc
aaccaggtgcggtccccagcgcccgttcagtctccccgtccccagtcccagccgccacat
tccagcccttcaccgcggatacagccccagccgtcaccgcaccacgtctctccccagact
ggttccccccacccaggactcgcagttactatggctagctccatggatcagggacacttg
ggcaacccagaacagagtgcaatgcttccacaactaaacaccccgaacaggagtgcgttg
tctaacgagttgtctctggtcggtgacaccaccggggacacgttagaaaaatttgtggag
ggtttgtag

DBGET integrated database retrieval system