KEGG   Anas platyrhynchos (mallard): 101800900Help
Entry
101800900         CDS       T02816                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00562  Inositol phosphate metabolism
apla04012  ErbB signaling pathway
apla04068  FoxO signaling pathway
apla04070  Phosphatidylinositol signaling system
apla04140  Autophagy - animal
apla04150  mTOR signaling pathway
apla04210  Apoptosis
apla04218  Cellular senescence
apla04370  VEGF signaling pathway
apla04510  Focal adhesion
apla04620  Toll-like receptor signaling pathway
apla04625  C-type lectin receptor signaling pathway
apla04810  Regulation of actin cytoskeleton
apla04910  Insulin signaling pathway
apla04914  Progesterone-mediated oocyte maturation
apla04933  AGE-RAGE signaling pathway in diabetic complications
apla05164  Influenza A
Module
apla_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101800900 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101800900 (PIK3CB)
   04370 VEGF signaling pathway
    101800900 (PIK3CB)
   04068 FoxO signaling pathway
    101800900 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101800900 (PIK3CB)
   04150 mTOR signaling pathway
    101800900 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101800900 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    101800900 (PIK3CB)
   04218 Cellular senescence
    101800900 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101800900 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101800900 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101800900 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101800900 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    101800900 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101800900 (PIK3CB)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101800900 (PIK3CB)
  Infectious diseases
   05164 Influenza A
    101800900 (PIK3CB)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101800900 (PIK3CB)
Membrane trafficking [BR:apla04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101800900 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Motif
Other DBs
NCBI-GeneID: 101800900
NCBI-ProteinID: XP_005028645
Ensembl: ENSAPLG00000003554
Position
Un
AA seq 1066 aa AA seqDB search
MPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISHIKQLLWKQAHSY
PLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSKI
GVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPVIPE
NFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEDIDPAD
YVLQVSGRLEYVFGDHPLIQFQYIRNCVMNRTLPQLTLVECCTIKKMCEQEMIAIEAAIN
RKSSNLPLPLPPKKTRATTSVWDVCSPFKITLLKGNKLNTEENAKVHVRAGIFHGTELLC
KTVVSTEISGRSDHVWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKY
QTIRKAGKVHYPVAWVNTMVFDYKGQLRNGEFVLHSWSSFPDELEEMLNPMGTVQTNPYI
ENATALHIKFQEYSKHPINYPPFDKILEKAAEIARSSDNAAMAGRGGKKFFVVLKEIMER
DPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPR
EALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERA
LANRRIGQMLFWHLRSEVHIPAVSIQFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNS
LIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCRYMDSKMK
PLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDILWKEAGLDLRILPYGCLAX
XXXSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIEEFTLS
CAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDF
IHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVKDIQYL
KDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgccgtgacagacagcctggacatctgggcagtggattcacagattggtgct
gatggctcaatatctgtggacttcctattgcccactggaatctacatcaacctggatgtc
cctcgagatgccaccatatctcatattaaacagctgttatggaagcaggcacatagctat
ccactcttccatctccttatggagattgactcttacatgttctcatgtgtgaatcaaact
gcagtacatgaagaattagaggatgaaacacgaagactttgtgatgttagaccctttctt
cctgtccttaaactagtgacgaggaattgtgatccaggagaaaagttggattccaaaata
ggtgtcctcataggcaaaggtcttcatgagtttgatgccttacaagatcctgaagtgaat
gacttccgagctaaaatgcggagaatcagtgaggaaaaaattcagtcactcgtgggtctt
tcctggatggactggttaaagcacacatacccgccagaacaggaacctgttatcccagag
aacttccaagataagctgtatagtggaaatcttgtagtggccgttcattttgataactgc
caggatgtatttagttttcaggtgtctcctaacatgaatcccatcaagttgaatgagctg
gcaatccgaaaacgtttgactatccatggaaaagaagatgaggacattgatcctgctgat
tatgtgctgcaagttagtgggaggctagagtacgttttcggtgatcacccattaattcag
tttcagtatatacgcaactgtgtgatgaacaggactcttcctcagctgactctagttgaa
tgttgtaccataaagaaaatgtgtgagcaggagatgattgccatagaagctgccataaac
cgaaaatcatccaaccttcctcttcctctgccaccaaaaaaaacaagagcaacaactagt
gtgtgggatgtttgcagccctttcaagattactctgttaaagggtaataaactaaataca
gaagaaaatgccaaagttcatgttagggctggtatattccatggtacggagctcctttgt
aaaacagttgtaagcacagaaatatctgggagaagtgaccacgtttggaatgaagtactg
gagtttgaaataaatgtctgtgatctaccaagaatggcgaggctctgttttgcagtttat
gctgtgatggataagatgaaaactaaaaagtcaactaaggcaatgaatccctccaaatac
caaaccattaggaaagcaggaaaagtgcactatcctgtagcctgggtaaataccatggta
tttgattataaaggacaactgaggaatggagaatttgtactgcacagttggtcatcattt
cctgatgaacttgaagaaatgttaaatccaatgggaactgtccagactaacccttacatt
gaaaatgcaacagctttgcacattaaatttcaagaatattcaaaacatcctattaattac
cctccctttgataagatacttgaaaaggcagctgagattgcaagaagcagtgacaatgct
gcaatggcgggtcgaggtggtaagaagttttttgttgtgctaaaagaaataatggaaaga
gatcctttatctcagctctgtgaaaatgaaatggatcttatttggactttgcgatatgac
tgtcgtgaaaattttccacaatcattgccaaaactgctgctgtccttaaaatggaacaaa
cttgaagatgttgctcagcttcaggctctccttcagatatggcccaagctgctgcctaga
gaagcattagaattgttggatttcaattatccagaccagtacgtgagagaatatgcagtg
ggatgtttaaagcaaatgagcgatgaagagctctctcagtatcttcttcaacttgtgcaa
gtcctgaaatatgaaccttttcttgattgcgctctctccagatttctattagagagagca
cttgctaataggagaataggacagatgctgttttggcatctaaggtcagaggttcacata
cctgctgtttcaatacagtttggtttgatacttgaagcttactgccgaggaagtgttgct
cacatgaaagtgcttgctaaacaggtggaagcccttaataaaatgaagactttaaacagc
ttaattaagctgaatgccatgaaacaaagcaaagcaaaaggaaaagatgcaatgcacacg
tgtttgaaacaaaatgcttacagagaagcactttctgacctccagtctcctctgaatcct
tctgttatactttcagaactacacgttgagaagtgtagatatatggattctaaaatgaag
cctctatggatagtatacaacaataagatgtttggaggagatcttgtagggatcatcttt
aaaaatggtgatgatctccggcaggacatgttgacactccagattttgcgtttgatggac
atactttggaaagaagctggcctggatctccggatattgccctatggctgtttagcaann
nnnnnnnnctctggccttattgaggctgtttctagttcagaaaccattgctgatattcag
ttaaatagtagcaacgttgctgctgctgctgccttcaacaaagatgctctcttaaactgg
ctgaaggaatacaatttaggagatgacttggatcgagccattgaagaattcactctgtct
tgtgctggctactgtgtagctacttacgtgttggggattggtgacagacacagtgacaat
atcatggtcagaaaaaatggccagctctttcacatagattttgggcatattcttgggaac
ttcaaatccaagtttggaattaaaagggaacgggtacctttcatactcacctatgatttc
attcatgttatacaacaaggaaaaacagggaacactgaaaaatttggtcggttccgccag
tattgtgaagaagcatacttgattctacgaaagcatggaaatctatttataacactcttt
gcactgatgttaactgcagggcttccagagctaacctctgtcaaggacatccagtatctc
aaggactctcttgccttagggaagagtgaggaagaggcactaaagcaatttaagcaaaaa
tttgatgaagcactccgggaaagttggactactaaagtgaactggatggctcacactgtt
cggaaagattacagatcctag

DBGET integrated database retrieval system