KEGG   Anas platyrhynchos (mallard): 101801349Help
Entry
101801349         CDS       T02816                                 

Gene name
SCD, SCD1
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101801349 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101801349 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101801349 (SCD)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101801349 (SCD)
Lipid biosynthesis proteins [BR:apla01004]
 Desaturase
  First
   101801349 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MRACSGGLSLRQGKQEFSSASSTTTVGTVTSRVTKNGDAVMEKDLLSHEDLAAARGMVDD
IFDETYREKEGPKPPLRYVWRNIILMSLLHLGAIFGLTLIPSAKIQTLAWAVLCFVVSAL
GITAGSHRLWSHRSYKATLPLRIFLTIANSVAFQNDIYEWVRDHRVHHKFSETDADPHNA
MRGFFFSHIGWLLVRKHPDVIEKGQKLDLSDIKADKVVMFQRKYYKPSVVLLCFTLPTVV
PWYFWDESIIISFFIPAILRYTIGLNATWLVNSAAHMFGNRPYDQNINPRENPLVSLGAL
GEGFHNYHHTFPYDYSTSEFGWRFNLTTAFIDFMCLLGLASDRKKVSKEVILARKMRTGD
GSHKSG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcctgctcgggcgggctgtcactgcgccagggcaaacaagagttctcctccgct
tccagcaccaccaccgtcggcactgtcacctcccgggtgaccaagaatggggatgccgtc
atggagaaggacttactcagtcacgaggacttggcagcagcccggggcatggtagacgac
atctttgatgagacctaccgtgagaaggagggccccaagcctcccttgcgatacgtctgg
aggaatattatcctcatgagcctgctgcatctaggggccatattcgggttgacactgata
ccttctgcaaagatccagaccttggcgtgggccgttctgtgtttcgtggtgagcgctctg
gggataacagctggatctcaccgcctctggagccatcggtcctacaaagccacgctgccc
ctgcggatcttcttgactattgcaaactccgtggccttccagaatgacatctacgagtgg
gtccgggaccatcgtgtccaccacaaattctccgagacagatgcagacccccacaacgcc
atgcggggctttttcttctcccacattggctggctgctggtgcgcaagcacccagatgtg
atagagaagggccagaagctggacctgagcgacataaaggccgacaaagtggtgatgttc
cagcggaaatactacaagccctcggtggtgttgctgtgcttcaccttgcccactgtagtg
ccctggtacttctgggacgaatccatcatcatcagcttcttcattccagccatcctgcgc
tacaccatagggctcaatgccacttggctagtgaacagtgctgctcacatgtttggcaac
cggccatatgatcagaacatcaacccacgggagaaccctctggtcagcctgggtgcccta
ggagaaggcttccacaactaccaccacaccttcccctatgactattctaccagtgagttt
ggctggcgtttcaacttaaccacagccttcatcgacttcatgtgcctcctggggctggcc
agtgatcgcaagaaggtctccaaggaggtcatcctggctcggaaaatgcggactggagat
gggagtcacaagagtggctga

DBGET integrated database retrieval system