KEGG   Anas platyrhynchos (mallard): 101801800Help
Entry
101801800         CDS       T02816                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:apla00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 746 aa AA seqDB search
MEIWAFKGDRGVLAKGESGEAKGKGRGVPELLTLLWDTAHRRLAAARCPAGSWQRAVAAR
EGACEMGLGVEYALFYNRLKSIEENEGGLDKFSKSYKTFGVNQFVDGGVYCKEWAPGAEA
VFLTGDFNGWNPFSHPYKKMEYGKWELFIPPGQDGYSPVPHGSKLKVVIRAQNGELLYRI
SPWARYVVRDQDKVNYDWVHWNPPQSYIRKHRSPERLKSLRIYESHVGIASPEGKIASYK
NFTYNVLPRIKDLGYNCVQLMAIMEHAYYASFGYQVTSFFAASSRYGTPDDLKEMIDVAH
SMGITVLLDVVHSHASKNSEDGLNKFDGTDSCFFHSGPKGTHQLWDSRLFDYSNWEVLRF
LLSNLRMWIEDYGFDGFRFDGVTSMLYHHHGIGTGFSGDYNEYFGLHVDEDALCYLMLAN
HMVNFLHPECITIAEDVSGMPALCRPVAEGGGGFDYRLAMAIPDKWIQIIKELKDEDWNM
GNIVYTLTNRRYEEKCIAYAESHDQALVGDKTLAFRLMDAEMYTNMSVLSPLTPVIDRGI
QLHKMIRLITHALGGDSYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDHLLRY
RFLNAFDRDMNKSEERFGWLASPPAFVSEKHESNKVIAFERAGLLFIFNFHPYQSYTDYR
VGVEIPGKYKILLDSDASEYGGHQRLDHNTEYFSEEYPHNYRHNSLMQYNSQTSFSQQSR
RCHKHHIKVYIPSRVAIVLQNMDNAK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggaaatctgggctttcaaaggcgaccggggtgtgttggcgaagggggagagcggggag
gcgaaagggaagggaaggggagttcctgagctgctcaccttgctgtgggacacagcacac
cgccggcttgctgctgctcggtgtcccgctggttcctggcagagagcggtagcagcgagg
gaaggggcttgtgaaatgggattaggagttgagtatgctctgttttacaaccgcttgaag
agcattgaggaaaatgaaggtggtcttgataaattttcaaaaagttacaaaaccttcgga
gttaaccaatttgtggatggtggagtatattgcaaagagtgggcaccgggagcagaagcg
gtgtttctcacaggtgacttcaatggctggaatccattttctcacccatataagaaaatg
gagtatgggaaatgggagctgttcattccacctggacaagacggttattctcctgttccc
catggatcaaagctaaaggtggtgattcgtgctcaaaatggcgaactgctctatcgtatt
tcaccttgggcaagatatgtagtccgtgatcaagataaagtgaattacgattgggtacac
tggaatccaccacaatcatatatacgtaagcatcgttcccctgagagattaaaaagccta
agaatctatgaatctcatgtgggaattgcttccccagaagggaaaatagcttcttataaa
aacttcacatacaatgtactacctagaataaaggatcttggctataactgcgttcagctg
atggctattatggaacatgcatactatgccagttttggttaccaggtcacaagcttcttt
gcagcatcaagccgttacggaactccagatgatctgaaggaaatgattgatgttgctcac
tcaatgggtatcactgttctgctggatgtcgtgcacagccatgcatcaaaaaactctgaa
gatggtctcaacaaatttgatggtacagattcttgtttcttccattccggtcctaaagga
actcatcagctctgggacagcaggctcttcgattattcaaactgggaagttttgagattc
cttctttccaatttgagaatgtggatcgaagattatggctttgatggcttccgatttgat
ggtgttacatctatgctgtatcatcatcatggaattggcacaggattcagtggggattac
aatgaatattttggcctacatgtggatgaagatgctttgtgttatctaatgctggccaac
cacatggttaacttcttgcatccagaatgcataaccatagcagaggatgtttctggaatg
ccagctctttgccgtcctgttgcagagggaggaggaggatttgattatcgactagccatg
gctattccagataagtggatacagatcattaaggagctgaaagatgaagactggaatatg
ggaaatattgtgtatacgctaacaaacaggcggtatgaagaaaaatgtattgcatatgca
gagagccatgaccaggcacttgttggtgataagacactggcatttcgattgatggatgca
gagatgtatacaaacatgagtgtgctctcgcctctaactccagttattgatcgtggaata
cagcttcataaaatgattcgtctcattactcatgcacttggaggagacagctatctcaac
ttcatgggtaatgaatttggtcatcctgaatggcttgacttccccagaaaagggaataac
gagagctatcactatgccagaagacaatttaatcttactgatgatcatcttcttcgctat
agattcctaaatgcatttgatagagatatgaataaatcggaggaaagatttggctggctt
gcatctcccccggcctttgtgagtgaaaagcatgaatccaataaggtcattgcatttgag
agagcaggtcttctttttattttcaacttccacccataccaaagttatacagactacaga
gtaggtgttgaaattccaggaaagtataaaatccttctggattctgatgcttcagaatat
gggggacatcaaaggctggaccacaatacagagtatttctctgaagaatatcctcacaat
tatcgacataattcacttatgcagtacaattcacagaccagcttcagtcaacagtccaga
agatgccacaagcaccacataaaggtgtacattccaagcagagtggctattgtgcttcag
aatatggataatgcaaaatga

DBGET integrated database retrieval system