KEGG   Anas platyrhynchos (mallard): 101801800Help
Entry
101801800         CDS       T02816                                 

Gene name
GBE1
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme 1
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101801800 (GBE1)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101801800 (GBE1)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101801800 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
CGLYALAFLNISKTLAKLSKNVSVFFERYALFYNRLKSIEENEGGLDKFSKSYKTFGVNQ
FVDGGVYCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMEYGKWELFIPPGQDGYSPVPHGS
KLKVVIRAQNGELLYRISPWARYVVRDQDKVNYDWVHWNPPQSYIRKHRSPERLKSLRIY
ESHVGIASPEGKIASYKNFTYNVLPRIKDLGYNCVQLMAIMEHAYYASFGYQVTSFFAAS
SRYGTPDDLKEMIDVAHSMGITVLLDVVHSHASKNSEDGLNKFDGTDSCFFHSGPKGTHQ
LWDSRLFDYSNWEVLRFLLSNLRMWIEDYGFDGFRFDGVTSMLYHHHGIGTGFSGDYNEY
FGLHVDEDALCYLMLANHMVNFLHPECITIAEDVSGMPALCRPVAEGGGGFDYRLAMAIP
DKWIQIIKELKDEDWNMGNIVYTLTNRRYEEKCIAYAESHDQALVGDKTLAFRLMDAEMY
TNMSVLSPLTPVIDRGIQLHKMIRLITHALGGDSYLNFMGNEFGHPEWLDFPRKGNNESY
HYARRQFNLTDDHLLRYRFLNAFDRDMNKSEERFGWLASPPAFVSEKHESNKVIAFERAG
LLFIFNFHPYQSYTDYRVGVEIPGKYKILLDSDASEYGGHQRLDHNTEYFSEEYPHNYRH
NSLMQYNSQTSFSQQSRRCHKHHIKVYIPSRVAIVLQNMDNAK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
tgtggtctttatgctcttgcatttctcaatataagtaagacacttgctaagctttctaaa
aatgtatctgttttctttgaaaggtatgctctgttttacaaccgcttgaagagcattgag
gaaaatgaaggtggtcttgataaattttcaaaaagttacaaaaccttcggagttaaccaa
tttgtggatggtggagtatattgcaaagagtgggcaccgggagcagaagcggtgtttctc
acaggtgacttcaatggctggaatccattttctcacccatataagaaaatggagtatggg
aaatgggagctgttcattccacctggacaagacggttattctcctgttccccatggatca
aagctaaaggtggtgattcgtgctcaaaatggcgaactgctctatcgtatttcaccttgg
gcaagatatgtagtccgtgatcaagataaagtgaattacgattgggtacactggaatcca
ccacaatcatatatacgtaagcatcgttcccctgagagattaaaaagcctaagaatctat
gaatctcatgtgggaattgcttccccagaagggaaaatagcttcttataaaaacttcaca
tacaatgtactacctagaataaaggatcttggctataactgcgttcagctgatggctatt
atggaacatgcatactatgccagttttggttaccaggtcacaagcttctttgcagcatca
agccgttacggaactccagatgatctgaaggaaatgattgatgttgctcactcaatgggt
atcactgttctgctggatgtcgtgcacagccatgcatcaaaaaactctgaagatggtctc
aacaaatttgatggtacagattcttgtttcttccattccggtcctaaaggaactcatcag
ctctgggacagcaggctcttcgattattcaaactgggaagttttgagattccttctttcc
aatttgagaatgtggatcgaagattatggctttgatggcttccgatttgatggtgttaca
tctatgctgtatcatcatcatggaattggcacaggattcagtggggattacaatgaatat
tttggcctacatgtggatgaagatgctttgtgttatctaatgctggccaaccacatggtt
aacttcttgcatccagaatgcataaccatagcagaggatgtttctggaatgccagctctt
tgccgtcctgttgcagagggaggaggaggatttgattatcgactagccatggctattcca
gataagtggatacagatcattaaggagctgaaagatgaagactggaatatgggaaatatt
gtgtatacgctaacaaacaggcggtatgaagaaaaatgtattgcatatgcagagagccat
gaccaggcacttgttggtgataagacactggcatttcgattgatggatgcagagatgtat
acaaacatgagtgtgctctcgcctctaactccagttattgatcgtggaatacagcttcat
aaaatgattcgtctcattactcatgcacttggaggagacagctatctcaacttcatgggt
aatgaatttggtcatcctgaatggcttgacttccccagaaaagggaataacgagagctat
cactatgccagaagacaatttaatcttactgatgatcatcttcttcgctatagattccta
aatgcatttgatagagatatgaataaatcggaggaaagatttggctggcttgcatctccc
ccggcctttgtgagtgaaaagcatgaatccaataaggtcattgcatttgagagagcaggt
cttctttttattttcaacttccacccataccaaagttatacagactacagagtaggtgtt
gaaattccaggaaagtataaaatccttctggattctgatgcttcagaatatgggggacat
caaaggctggaccacaatacagagtatttctctgaagaatatcctcacaattatcgacat
aattcacttatgcagtacaattcacagaccagcttcagtcaacagtccagaagatgccac
aagcaccacataaaggtgtacattccaagcagagtggctattgtgcttcagaatatggat
aatgcaaaatga

DBGET integrated database retrieval system