KEGG   Anas platyrhynchos (mallard): 101802378Help
Entry
101802378         CDS       T02816                                 

Definition
uncharacterized LOC101802378
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101802378
   00053 Ascorbate and aldarate metabolism
    101802378
   00500 Starch and sucrose metabolism
    101802378
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101802378
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101802378
   00860 Porphyrin and chlorophyll metabolism
    101802378
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101802378
   00982 Drug metabolism - cytochrome P450
    101802378
   00983 Drug metabolism - other enzymes
    101802378
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101802378
Glycosyltransferases [BR:apla01003]
 Others
  Hydrophobic molecule
   101802378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1312 aa AA seqDB search
MLVAVLLPFLCCLGSAAAGKVLVIPMEGSHWLSMKEVLIELSKRGHEIIVMAPEMKTIVD
SSEWYTLKTYPVPLKEEEMEDLLHSLTANSFNDQPFIYRFLNIWDIFKKSSAVFEVACSS
LLHNKEMMKFIEESKFDVMFTDPVTPCGQIIALHFSIPSAFFLRAIPCAIDTHAAQSPDP
PSYVPRMFSLNTDHMTFPQRVENVLIAISEAFTCRIIFSPFERLASDFLQKPITVTELLS
HGSIWLKRLDFVFDYPTPVMPNMIFIGGINCARKKPLSQHGAGAVASVLPADFFLGSTHR
VPAGMAPVPASHLQVTVTLVLLLSVLGLAAGGKVLALPVGGSHWLSMREVLEGLKAKGHE
VVVAAPEINLHIKPTDNFTMKMYPVPFTQEEMDKDFHAFLKGGFEEGSFLERFVRTYQRM
KRLSDFAFISCEHLLYNKELMRYLEESKFDVVFTDPVIPCGPIVAEHLSVPSVYFLRGIP
CGLDFEATQCPNPPSYVPRVFTEHTDHMSFLQRVKNLVFDVQNFFLCDFMYKPYSKLASE
FLQRDMTVLDLLRKASVWLLRLDFVLDYPRPLMPNIVLIGGVNCAHKELPQVGRAPFLLL
VLTDVCVCKSARVMEEQRLFSANTDRMNFLQRVKNVLFDIPNNLLCYFMFQPYSKLASEF
LQRDVTVLDLLRNASIWLMRFDFVFHYPRPLMPNMVIIGGITCTHRKLTQEEMDTTFQRT
GQQVFEEGTFLERIVKTYEGVKNTSAIFLSTCEHLLYNKELIRYLEEILHPLKTLLAFHS
ARKMAFVNLGFNFLTSWAVFFLLLWNFCEGGKLLVVPIDGSHWLSMRPIVERLRQRGHEI
VIVAPEINLRIDSSVHYTMKTYSVPYTREYVEAEFKKLGYRSFTPQPFLEKFSKVANITK
MFFDSCKMLLSDKELIKYLEESTFDAVLMDPFFPCGQILAEHLSIPSVYLVRGLPCSLDF
HATLCPNPPSYIPRFFTRYTDRMGFLQRVVNVIVSLSNSLTCSLFYSPYDILIKEFLQKE
ATLLEILSHASIWLMKYDFVFEYPRPVMPNMVLIGGISCTQEKPLSKEFEAIVNASGEHG
IVVFSLGSMVSDIPMKKAREIADALGSVPQTVLWRYTGKVPSNLPQNVKLVKWLPQNDLL
AHPKTRAFITHGGSHGVYEGICNAVPMVLMPLFGDQMDNAKRVESRGAGLTLNILEMTSE
DMSNALKTVINDKKYKENIKRLSELHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAAHDL
NWIQYHSLDVIAFLLAVVLLSLFISFKCCMFCCRRCCFKKGRTRKPAKSKSH
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggctgtgctgctccccttcttgtgctgcctgggtagcgctgctgctgggaag
gtgctggtgatcccgatggagggcagtcactggctcagcatgaaggaagtgctgattgag
ctgagcaagagagggcatgaaataattgtcatggcaccagagatgaaaacgattgtagat
tcctcagagtggtacacgctgaaaacataccctgtacctttaaaagaggaagagatggaa
gatcttctgcattcacttactgcaaacagttttaatgaccagccttttatttacagattt
ttgaatatttgggatatttttaaaaagagttctgccgtctttgaagttgcttgcagttcc
ctactgcacaacaaagagatgatgaaattcattgaagaaagcaaatttgatgtcatgttt
acagaccctgtgacaccctgtggacaaataattgctttgcatttttctatcccttctgct
ttcttcttgcgggctatcccatgtgctatagacactcacgccgctcagagtccggaccca
ccgtcctacgtcccacgaatgttctccctcaatacagaccatatgacatttcctcagaga
gtcgagaacgtactgattgccatttcagaggctttcacctgcagaatcatcttttcacca
ttcgaaagactggcctcggacttcctccaaaagcccatcacggttacagagcttttaagc
cacgggtccatttggctgaagagactggactttgtctttgactaccccacacccgtgatg
cccaatatgattttcattggaggcatcaactgtgcacggaagaagccgttatctcagcac
ggagctggtgctgttgcttcagtgctgcctgcagacttctttctgggcagcacgcaccgg
gttcctgcagggatggccccagtgcctgcttctcacctgcaagtcacagtgacgctggtt
ctgctcctgtccgtgctcggtctggctgctggtgggaaagtgctggcactgcctgtaggt
gggagtcattggctcagcatgcgggaagtgttggagggtctcaaggcgaaagggcatgaa
gtagtcgtcgctgcacctgaaatcaatttacacataaaaccaacagacaattttactatg
aaaatgtacccagtccctttcacacaggaagagatggataaggacttccacgcattttta
aagggtgggtttgaagaaggatcctttctggaaagatttgttagaacataccaaaggatg
aaaagactctctgactttgcattcatcagctgtgaacacttactgtacaacaaagaactt
atgagataccttgaggagtctaagtttgatgttgtctttacagaccctgtaataccttgc
gggccgatagtggctgagcacctttcggtcccttctgtctattttctgcgaggaattcca
tgtggcttagattttgaagccactcagtgtcccaatcccccttcttatgtccccagggtg
tttacagaacacacagaccacatgagcttcctccagcgtgtgaagaatctggtctttgat
gtccaaaattttttcctctgtgattttatgtataagccgtactccaaactggcttctgag
ttccttcagcgagatatgactgtgttagatctcttacgcaaggcttccgtatggcttctg
agattagactttgtgttagattatccaagaccgttgatgcccaacatagttttaattggc
ggagtgaattgtgctcacaaggagctacctcaggtaggtcgtgctccattcttgcttctt
gttctgactgacgtctgtgtttgcaagagcgcacgtgtgatggaagagcagaggctattc
agtgccaatacagaccgcatgaacttcctccagcgcgtgaagaacgtattatttgacatt
ccaaataacctcctctgctatttcatgtttcaaccgtactctaaactggcttctgagttc
cttcagcgggatgtgaccgtgttagatctcttacgcaatgcatctatttggcttatgcga
ttcgactttgtattccattatcccaggccactgatgccaaacatggtcattattggagga
ataacatgcactcacaggaagctaactcaggaagagatggataccactttccagagaact
ggacagcaagtatttgaagaaggaaccttcctggaaagaattgttaaaacgtatgagggt
gtgaaaaatacttctgccatattcctgtctacctgtgaacacttactgtacaacaaagag
cttatcagataccttgaggagattctgcatccacttaaaaccttgctggctttccacagt
gcaaggaaaatggcctttgtgaatctgggatttaattttcttacctcctgggctgtgttt
ttcctgctcctgtggaatttttgtgaaggtggaaagcttttggttgtacccatcgatggc
agtcactggctcagcatgcgcccgattgtggagcggctcaggcagagaggacatgaaata
gtgattgttgcgccagagataaacctgcggatagattcatcagtgcactataccatgaaa
acatactccgtgccttacaccagggagtacgtggaggcagaatttaaaaagctaggctat
aggagtttcacacctcaacccttcttggaaaaattctccaaagtggcaaatatcacaaaa
atgttttttgattcctgcaaaatgcttctttctgataaagagctgatcaaataccttgaa
gaaagcacatttgatgctgttcttatggatccttttttcccctgtggacagattctggct
gaacatctctccataccttccgtgtacctcgtgcggggactgccgtgcagcctggacttc
catgctaccctctgcccaaatcctccttcttacattcctaggttcttcacacgctacact
gatcgcatgggcttcctccagcgtgtggtcaatgtcatcgttagcttgagcaattcccta
acctgtagtcttttttattcaccgtacgatattttgatcaaagaattccttcagaaagag
gcaacactgctagaaattttaagccatgcatctatttggctcatgaaatatgactttgtg
tttgagtatcccaggcctgtcatgcctaacatggtcttgattggaggcataagctgtact
caggaaaaaccattgtcaaaggaattcgaagccatcgtcaatgcttctggagagcatggc
atcgttgtcttctcactgggctccatggtctctgacattcctatgaagaaagccagagaa
attgcagatgctttgggatcagtccctcagacggttttgtggcgatacacaggaaaggtg
ccctccaacctgccgcagaacgtaaagcttgtcaaatggctgccacagaatgatcttcta
gctcaccctaagactcgtgcctttattacccacggaggctcacatggtgtttatgagggc
atatgcaatgcagtgccaatggtactcatgcctttgtttggagaccagatggacaacgca
aagcgagtagagtcacggggagcaggactgacactgaatatacttgaaatgacttcagaa
gacatgtctaacgccttgaaaacagttattaatgataaaaagtacaaggagaacatcaag
cgtctctcagaacttcacctcgacaggcccatccaccccctggacctggccgtgcactgg
gtggagttcgtcatgaggcacaaaggggccccacacctgcgacctgctgctcatgaccta
aactggatccagtaccactccctggatgtcatcgccttcctcctggccgtggtgctcctc
tccctctttatttctttcaagtgctgcatgttctgctgccgcaggtgctgctttaagaag
ggaagaacacgcaagccagccaaatcaaagtcccactag

DBGET integrated database retrieval system