KEGG   Anas platyrhynchos (mallard): 101802983Help
Entry
101802983         CDS       T02816                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101802983 (MGLL)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101802983 (MGLL)
Peptidases [BR:apla01002]
 Serine Peptidases
  Family S33
   101802983 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPATAARALVFIAHGAG
EHCGRYDDLAQRLTELNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKDHP
GLPVFILGHSMGGAISILTASERLGDFSGMVLISPLVVASPEVATPIKVFAAKVLNLVLP
NLSLGSIDPNAVSRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPVL
VLHGSSDKLCDIRGSHILMDTVQSQDKTLKVYEEAYHALHKELPEVTTSVFTEILTWVGQ
KVSAAGETSHT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcctccagaatgccagaggaaagttcgccaaagcggagtcctcaa
aacatcccgtacaaagacctgccccacatcatcaatgctgacgggcagcatctcttctgc
aggtactggaagccagcaacagctgccagggccctcgtgtttatcgctcacggcgctggg
gaacactgcggccgttacgatgacttggcccagaggctgacagaacttaacttgtttgta
tttgcccatgaccatgttggccatgggcagagcgagggggatcgtatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagatcaccct
gggctgcccgttttcatcctgggacattccatggggggagccatctccattctgacagct
agcgagagactcggtgacttttcgggcatggtgttaatctctcctttagtggtggccagc
ccagaagtcgccacccccatcaaggtttttgcagcaaaagtgctcaacctcgttctccca
aacctgtcactgggatcgatagatccaaatgcagtttcccggaacaagaaagagatggag
tcctacacatccgatcccctggtctaccacggtggcatgaaggtgtccttcgtcatccag
ctgatgaacgccattgccagaattgagcgagctctgcccaagctgactttgcccgtcctg
gtgctacacggctcttccgacaagctctgtgatatcagagggtcccatatactgatggat
acagtgcagagtcaggacaaaaccctcaaggtgtatgaggaagcctaccatgccctccac
aaagagctgcccgaggtcactacctccgtcttcacggaaatacttacgtgggttggccag
aaggtctcagcagctggagaaaccagccacacttaa

DBGET integrated database retrieval system