KEGG   Anas platyrhynchos (mallard): 101803074Help
Entry
101803074         CDS       T02816                                 

Gene name
ALDH1L2
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L2
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101803074 (ALDH1L2)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101803074 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 909 aa AA seqDB search
SFDQAYQNKLKLALIGQSIFGQEVYNKLRKEGHKVVGVFTVPDKNGQADPLALAAEKDGT
PVFKFPRWRAKGKPIQEVVAAYKSVGAELNVLPFCTQFIPMDVIDCPKHGSIIYHPSILP
RHRGASAINWTLIQGDKKAGFTIFWADDGLDTGPILLQRECDVGQNDTVDDLYNRFLFPE
GVKAMVEAVDLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQPAAALHNWIRGHDKVP
GAWATVDGQVVTFYGSSLLDASVPAGQELTIKGASRPGLVTKNGLVIFGNDGKMVLVRNL
QFEDGKMIPASKYFSADETTALELTEEEKKMAEDIRAIWKGILSNIAVIEDSTDFFKSGA
SSMHVVRMLEEIKQKYSGLQLQNEDVYMATKFADFVQMAVRKLRGEDKEEELVIDYVSKN
VNNMTVNMPYQCFINGQFINADDGKTYDTINPTDGSIIASVSSASFADVDKAVAAAKEAF
ENGEWGRMNARERGRLMYRLADLMEEHQEELATIESIDSGAVYTLALKTHIGMSVQTFRY
FAGWCDKIQGATIPINQARPNHNLTFTKKEPIGVCAIVIPWNYPLMMLAWKSAACLAAGN
TLVLKPAQVTPLTSLKFAELSAKAGFPKGVINILPGSGGLVGQHLSKHPDVRKIGFTGST
PTGKEIMKSAATNLKKVSLELGGKSPLIIFNDCDLDRAVKMGMGAVYFNKGENCIAAGRL
FVEESIHDEFVRKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLV
YGGKQVCRPGFFMEPTVFTDVEDHMYIAKEESFGPVMVISKFKNGDVDGVLRRANSTEYG
LASGIFTKDISKALYISEKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALHEYL
RTKAITVEY
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
tcttttgatcaggcttatcagaataagctaaagctagcccttataggtcaaagcattttt
ggacaagaagtttataacaagctgagaaaagaaggccataaagttgtgggagtattcaca
gtgcctgacaagaatggacaagctgatcctttggcattggcagcagagaaggatggcact
cctgtttttaagtttcccagatggagagctaaaggcaagcctatccaggaagtagttgca
gcctacaaatccgttggagcagagctaaatgtccttccattctgtacacagttcatccct
atggatgttatcgactgcccaaaacatggctcaattatttaccatccatccatcctacca
cggcatcgaggagcttctgcaatcaactggactttaattcaaggagataagaaagcagga
tttacaattttctgggctgatgatggtttggacactggaccaatacttctgcagcgagaa
tgtgatgttggccaaaacgatactgtggatgatctgtataaccggtttctcttcccagag
ggcgtaaaggctatggtggaagctgtagatctaattgctgatggtaaggcacctcgtata
cctcagcctgaagaaggggcgacatatgaagggatccagaaaaaggaaaatgcagagatc
tcctgggatcaacctgcagcagctttgcacaactggatccgagggcatgataaagtacct
ggagcatgggcaacagtagatggccaggtggttactttttatggatcatcattacttgat
gcttcggtgcctgctgggcaagagttgacaataaaaggtgcttcaagacctggacttgta
accaagaatggcctggtcatttttggtaatgatgggaagatggtactagtgcgaaatcta
cagtttgaggatggaaaaatgatccctgcatctaaatatttctctgctgatgaaacaact
gccctggaacttacagaagaggaaaaaaagatggcagaagatattagggccatttggaaa
ggaattctgagcaatattgctgtaattgaggattccacagacttcttcaaatctggagca
tcctctatgcatgttgtcagaatgctagaagaaatcaaacagaaatatagtgggcttcag
ctacagaatgaagacgtgtatatggccactaagtttgcagactttgttcagatggctgtc
agaaaactcagaggagaggacaaagaagaagagttggtcattgattatgtttcaaaaaat
gtaaacaacatgactgtgaatatgccataccagtgttttataaatggtcaatttataaat
gctgatgatggaaaaacatatgacaccataaatccaacagatggatcaataatagccagt
gtatcttctgcttcattcgctgatgttgacaaagcagtggcagcagcaaaagaggcattt
gaaaatggtgaatggggaagaatgaatgcaagggagagagggcgactcatgtacagactt
gcagacctgatggaagaacatcaagaagagttagcaaccatagagtctattgattcagga
gcagtctacactttagctttgaagacccatattggaatgtctgtgcaaacattcagatac
tttgctggatggtgtgacaaaattcagggtgctacaattccaattaaccaggcccggcca
aaccacaatctaacattcaccaagaaagagccaataggtgtctgtgcaattgttatccca
tggaattacccactgatgatgcttgcatggaagagtgcagcatgcttggctgcaggcaac
acattggttctcaagccagctcaggtcacacctctgacttccttgaagtttgcagaactc
tcagctaaagctggatttcctaagggtgttataaatattctgcctggttcaggtggccta
gtgggacagcacctgtccaaacatccagatgttcgcaaaattggattcaccggttctaca
ccaactggtaaagagatcatgaagagtgcagccactaatctgaagaaagtttcacttgaa
cttggtggtaaatcaccactgatcatattcaacgactgcgatcttgacagagctgtaaaa
atgggtatgggagcagtatatttcaacaaaggagaaaactgcattgctgctggcaggctg
tttgtggaagagtcaatccacgatgaatttgttagaaaagtggtggaagaaattaaaaaa
atgaaaatcggtgacccactggatagatctacagatcatggtccacaaaatcacaaggcg
catttggaaaagctgctgcaatattgtgaaactggagtaaaagaaggagccactctagtg
tatggaggaaagcaagtatgtagaccaggttttttcatggaacccactgtattcacagat
gttgaagatcatatgtatattgccaaggaagagtcctttggtcctgtgatggtgatttcc
aaatttaaaaatggggatgtcgatggagtgctacgacgggcaaacagcacagaatacggg
ttagcttcaggcattttcacaaaagacataagcaaagcgctctatatcagtgaaaagcta
gaagctgggacagttttcataaatacatataacaaaactgatgtggcagcaccatttggt
ggatttaaacagtctggctttggaaaagatttaggtgaagaagctcttcatgaatatctc
agaacaaaggccatcactgtggaatattaa

DBGET integrated database retrieval system