KEGG   Anas platyrhynchos (mallard): 101803178Help
Entry
101803178         CDS       T02816                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101803178 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 628 aa AA seqDB search
MSPVECNKFSAFVLTAGSVVLXRNAGSSSDGTEDSDFSTDPEHTDSSESDGTSRRSARVT
RSSARLSQSSQDSSPVRNPPSFGAEEPVYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSE
TEQVVDFSDRDTKNAADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSMKDSG
SDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVR
AQSRDKQIEERMLAHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKY
MEHRQTYGNTREPLLENLTSEYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFG
RYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGS
ISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKE
KNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYW
KEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDE
WIAKEAKRSNSNKIMDPSCLKWTPPKGT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccgttgaatgtaataaattcagtgcctttgtgctaacggctggctctgtggtg
ttgtagaggaacgcaggcagtagctcagacgggacggaagactcggatttctccaccgac
ccggagcacacagacagctcggaaagcgatggcacctcacggcgctctgcccgcgtaacc
cgctcctcggccaggctcagccaaagctctcaagattccagcccggttcgtaatccaccg
tcatttggagcagaagagcctgtctattctacgaggagggtaactcgcagccagcagcag
cccactcctgtgactccaaagaaatacccgctccggcagactcgttcatctggatcagaa
actgagcaagtggttgacttctctgacagagacactaaaaatgcagcggatcacgatgag
tctccacctcgtacccccaccgggaatgccccttcctcagagtctgatattgatatctcc
agtccaaatgtatcccatgatgagagcattgccaaggacatgtccatgaaggattctgga
agtgacctgtctcaccgccctaagcgccgccgcttccatgaaagctacaatttcaacatg
aaatgtcccactcctggttgtaactctttaggccacctaactggaaaacacgagcgacac
ttctccatatcaggatgcccgctgtatcataatctctcagcagatgagtgcaaggtgcga
gcacagagccgagataaacagattgaggagaggatgctggcccatcggcaggatgacaac
aacaggcacgccaccagacaccaggcaccaaccgagagacagcttcggtacaaagagaaa
gtagctgagctcaggaagaagaggaactcaggattaagcaaggagcaaaaagaaaaatac
atggagcacagacaaacatatggcaatacgagggagcctctacttgaaaacctgactagt
gaatatgaccttgagcttttccgaagagcacaagcacgggcatctgaggacctggaaaag
ttgcggctccagggccagatcacagaaggcagcaatatgattaaaacaattgcttttggc
cgttacgaactggacacgtggtatcattctccctacccagaggagtacgcccgcctgggc
cgtctctacatgtgtgaattctgtctcaaatacatgaagagccagacaatactgcgcaga
cacatggcaaaatgtgtttggaaacatccaccgggtgatgaaatctaccgcaaaggctcc
atttcagtttttgaagttgatgggaaaaagaacaagatctactgtcaaaacctgtgtctg
ctggcaaaacttttcttggaccataaaacactgtattatgatgttgaacccttcctgttc
tatgtcatgacagaagctgacaacactggctgtcacctgataggatatttctccaaggag
aagaattcttttctcaactacaatgtttcttgtatcctgacaatgcctcagtacatgagg
caaggttacggcaaaatgctcattgacttcagctatttgctttctaaagtagaagaaaaa
gttggctctccagaacgccctctgtctgatctgggtctcatcagctaccgtagttactgg
aaggaagttttgcttcgttacctgcataatttccaaggaaaagagatctctataaaagaa
atcagccaggagaccgctgtaaaccccgtcgacattgttagtacactgcaggcacttcag
atgctgaagtactggaagggaaaacacctggtcctaaaaagacaggatctgattgatgaa
tggatagccaaagaggcaaaaagatccaacagcaataagataatggatcccagctgtttg
aaatggacccctcctaagggaacttaa

DBGET integrated database retrieval system