KEGG   Anas platyrhynchos (mallard): 101803424Help
Entry
101803424         CDS       T02816                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:apla00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
LALLTLLSFASRFHRLPEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFPFQKPGDRYEQHNYMGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTACIL
IFDTGCITLSQYILLDPILMFFLMGAVLSMVKCNACADRPFSASWWFWLSLTGVNLAGAM
GVKFVGLFVVLLVGLNTIYDLWDLLGNLSLSLVMFGKHLLARVLCLILLPLALYTAMFAV
HFTVLNKSGPGDGFFSSAFQSQLIGNNLHNVSVPEHLAYGSVVTMKNLRMAGGYLHSHWH
LYPEGVGARQQQVTAYLHKDLNNLWIIKKHDSDTDLSDPSSPVEFVRHGDIIRLEHKETS
RNLHSHQHEAPLTRKHFQVTGYGINGTGDSNDFWRIEVVGRKPGKLIKVLRSQVRLTHVA
TGCLLGSSGKTLPKWGWEQVEVTCTPYLKDTPNSLWNFEDHINPKLPNISLDVLKPSFAE
ILLESHMVMIRGNSGLKPKDNEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVVWWL
NLFTIGLYLLTAISTAVALKRGVQLSSELKELSRVVLHGGGQIALGWLLHYLPFFMMGRV
LYFHHYFPAMLFSSMLTGITWDTLLKFFARFLSPSTAARRVYGGGILALVLLIVYSFYLF
HPLSYGMIGPMASDPSSPMAGLRWMDSWEF
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
ctggctctcctcaccctgctcagcttcgcctcccgcttccaccgcctgccggagccgccg
cacgtctgctgggatgaaacccacttcgggaagatggggagctactacatcaaccgcacc
ttcttcttcgacgtccaccccccgctggggaagatgctgattggacttgctggctacctt
agtggatatgatggcacatttccattccaaaagccaggggacagatacgaacagcacaac
tacatgggaatgagagggttctgtgcgttccttggctcctgcctggttcccttcgcctac
ctcacagtgctggaactgtccaagtcgctgccagcagccttactcacagcctgcatcctt
atttttgatacgggctgtattactttgtcccagtatattctgctggaccccattctgatg
ttcttcctgatgggagctgttctgagtatggtgaaatgtaacgcctgtgcagataggcca
ttttctgcctcctggtggttctggctgagcctgactggcgtgaaccttgctggagcaatg
ggggtaaagtttgttggcctctttgtagtcctcttggttggtctgaacacaatctatgat
ctgtgggacttgctggggaacctcagcctgtcactggtcatgtttgggaagcatttactg
gctcgtgtactctgcctcatcctgctcccgcttgccctctacacggccatgtttgctgtt
cattttacagtgttaaataaaagtggtcccggggacggtttcttcagttctgcctttcag
tcccagctgattgggaacaatcttcataatgtctccgttccagagcatttggcatatgga
tctgtggtcacgatgaagaaccttcggatggcagggggataccttcactcccactggcac
ctctacccagagggcgtaggggctcgccagcagcaggtcactgcctacttacataaagat
ttgaataacctgtggattataaagaaacatgactcagatacagatctgtcagacccctcc
agccctgtggagtttgtgaggcatggagatattattcgcctggaacataaagaaacttca
agaaatcttcacagtcaccagcacgaggctcccctgacaaggaagcattttcaggtcact
ggctatggaataaatggaacaggagactccaatgacttctggcggattgaagtggtgggc
agaaagcctgggaagcttatcaaagtcctgcggagtcaggtccggctaacccatgtggcc
acagggtgtttactgggctcttctggaaagactctgccaaaatggggttgggaacaagtg
gaagtcacctgcacaccatacctgaaggacactcccaactccctctggaactttgaagat
catatcaaccccaagttgcccaatatcagcctggatgttttgaagccttcttttgcagaa
attctgctagaatcccacatggttatgatccgggggaacagtggcctgaaaccaaaggac
aatgaagttacgtccaaaccctggcactggcctatcaactaccagggtctgcgtttttct
ggtgtcaacgagacagattatcgggtttatttgctgggaaacccggtggtttggtggcta
aatctgttcactattgggttgtatcttctgacagcaatttccactgctgtggcactgaag
agaggtgtccaactgtcatctgaactcaaagaactgtcccgagttgtgcttcatggtgga
ggacagattgctctgggctggctccttcattacctccccttctttatgatgggccgagtt
ctctactttcaccactactttcctgccatgcttttttccagcatgttgacaggaatcacc
tgggacacactactgaagttctttgctaggttcttgtcccccagcactgcagctagaaga
gtatatggaggagggatcctggcgctggttctactcatcgtgtacagcttctacctcttt
catcctctgtcctacgggatgataggaccgatggcctccgaccccagcagtcccatggca
ggactccgatggatggactcctgggagttctag

DBGET integrated database retrieval system