KEGG   Anas platyrhynchos (mallard): 101803525Help
Entry
101803525         CDS       T02816                                 

Gene name
BAP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101803525 (BAP1)
Peptidases [BR:apla01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101803525 (BAP1)
Ubiquitin system [BR:apla04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    101803525 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 616 aa AA seqDB search
FWLLFAAPGLGATRVLPGLVVAPSALWPEVTFGFCPFPGLFTLLVEDFGVKGVQVEEIYD
LQSKCQGPVYGFIFLFQDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKY
ESKLHILKMNRQTVLEALQQLIRVTQPELIQTQKSQESQSTEETKPASSKTVAPESTHPG
RSPCQGCFKPAWPALKRAHPGIGWLEGQRGHSASRSWSAPSLIQKYHGQARSQSSCTRGS
CSSGAQGAVISSXASVHRSSVHEVLPPHPAVGRLSAVVXLQEEEDLAAGVGRSRVPVRQH
QQYSDDEDDYDDDEEEEVRNTNSAIRYKRKGQVKQEHAAGAADGQLSVLQPNTINVLAEK
LKESQKDLSIPLSIKTSSSGAAVSEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFG
EEDGLLRIDCMRYNRAVRDLGPIISSGLLHLTEDGVFCPLAVADGGKSSPLSIKPGEEAQ
VAIKLEEKEGSEAGDSKEKVGLGRTSDHPGGEKYSPKELLALLKCVEAEIANYEACLKEE
VEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQR
KPDRRKRSRPYKAKRQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
ttttggctcctctttgctgcaccagggcttggggccacgcgtgtcctccctgggctggtg
gtggccccctctgcgctctggccagaagtaacctttgggttttgtccctttccaggtctc
ttcacgctcctggtcgaagattttggggtcaagggggtgcaggtcgaggagatttacgat
ctgcagagcaagtgccagggccccgtgtacggcttcatcttcctcttccaggacgaagaa
tggacagacaaagccaggagggtgatcatggagcgcatcggcctggccactgcaggggag
ccgtaccacgacatccgtttcaacctgatggcagtggtgcccgatcggaggatgaagtac
gagtccaagcttcacatcctgaagatgaaccgccagaccgtgctggaggccttgcagcag
cttatccgagtcactcagcctgagctgatccagacccagaagtctcaggaatctcagtct
actgaagagacaaagccagccagcagcaagaccgtggctccagagagcacccatccaggt
aggtccccatgccaggggtgtttcaagccagcgtggcccgctctgaagcgagcacatcct
ggcataggctggctggaagggcagaggggacactctgcatccaggtcctggtctgcaccg
agcttgatccagaagtaccacggacaagctcgcagccagagcagttgcacgagaggcagc
tgttcctcaggggcacagggagcagtgatttccagctgagcaagtgtacacaggagttct
gtccacgaggttcttcctcctcacccagcagtcggcaggctgtcagcggtggtgnttttg
caggaggaggaagacctggcggcaggagtgggtcgcagccgggtcccagtccgacagcac
cagcagtactcagatgatgaggatgactacgatgatgatgaggaagaggaagttcgtaac
accaactcagccatcaggtacaaaaggaaagggcaagtaaagcaagagcacgcagcaggg
gctgcggacggccagctctctgtcctccagccgaacaccatcaacgtcctggctgagaag
ctgaaagagtcgcagaaggacctctccatccccctgtccatcaagacgagcagcagcgga
gctgctgtgtccgagatcggcagcgccttcaactccccgctgcgctctcccatccgctcg
gccaaccccacccgcccctccagccccgtcacctcccacatctccaaggtccttttcggc
gaggaggacgggctgctgcgcatcgactgcatgcgctacaaccgggccgtcagggacctg
gggcccatcatcagctccgggctgctgcacctcacagaggatggtgtcttttgcccgctg
gctgttgcagatggggggaaaagctcccccttgtccatcaaacccggtgaagaggcccag
gttgccatcaaactggaggagaaggagggcagtgaggccggtgacagcaaagagaaggtg
ggacttggcaggaccagtgatcaccctgggggggaaaagtattctcccaaggagctgctg
gcactgctgaagtgtgtggaggcagagattgcaaactacgaggcctgcctgaaggaagag
gtggagaagaggaagaaattcaagattgatgaccagaggagaacccacaactacgatgag
ttcatctgtaccttcatctccatgctggcgcaggaaggcatgctggccagtcttgtggag
cagaacatctccgtccgcaggcggcagggagtcagcatcggccgtctccacaagcagagg
aagcccgaccgccggaaacgctcccgtccgtacaaagccaagcgtcagtag

DBGET integrated database retrieval system