KEGG   Anas platyrhynchos (mallard): 101803541Help
Entry
101803541         CDS       T02816                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101803541 (GLS)
   00220 Arginine biosynthesis
    101803541 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101803541 (GLS)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101803541 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 549 aa AA seqDB search
MNKKRFSTSKVKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDRPHNPMVNAGAIVITSLIKQGANNAEKFDYVMQ
FMNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVAILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGLMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSGMDMEQRDYDSRTALHVAAAEGHVD
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPSEDSNNGKENRT
VHKNLDGLL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagagattttcaaccagtaaagtgaagcaaggtctccttcccagcttggaa
gatttgctcttctatactattgcagaaggacaagaaaaaatacccgttcataaattcata
actgcactcaaatctacaggattacgtacctctgatcccaggttgaaagagtgcatggat
atgttaagactgacccttcaaacaacttcagatggtgttatgctggacaaagaccttttt
aaaaagtgtgtacaaagtaatattgtattgcttactcaagctttcaggaggaagtttgtc
attccagatttcatgtcgtttacttcgcatatcgatgagctatatgaaagtgctaaaaaa
cagtctggaggaaaggttgctgactatattccacaactggcaaagttcagcccggatttg
tggggtgtgtcactttgcacagtggatggacagaggcattcagttggagataccaaagtt
cctttttgtcttcagtcctgtgtaaagcctttgaaatatgctattgctgttaacgatctt
ggcacagagtacgtgcacagatatgtcggtaaagagcctagtggattaagattcaacaaa
ttgttcctgaatgaagatgacaggcctcataaccctatggtgaatgctggagcaattgtc
atcacatctttaatcaagcaaggagcaaataatgcagaaaaatttgactacgtgatgcaa
ttcatgaataaaatggctggtaatgaatatgttggattcagtaatgctacgttccagtcc
gagagagagagtggagatagaaactttgcaattggctactacttgaaagaaaaaaagtgc
tttccggaaggcacagatatggttgctatcctagacttctattttcagctttgctcaata
gaagtaacctgtgagtcagcaagtgtgatggcagcaactctggctaatggtggcttttgc
ccgatcaccggtgaaagagtcctgagtcctgaagcagtccggaataccttgagtttaatg
cattcctgtggcatgtacgacttctcagggcagtttgccttccatgttggtcttcctgca
aaatctggagttgctggtgggattctcctggttgttcctaatgtcatgggcttgatgtgc
tggtctcctcctttggacaagatgggcaacagcgttaaaggaatccatttttgtcatgat
ctggtttccttgtgtaatttccataattacgataacttgagacactttgcaaaaaagctt
gatcctcgcagagaaggtggtgatcagcgggtgaagtctgtgataaacctgctgtttgct
gcctacacgggggatgtgtctgcactccggagatttgctctgtcagggatggatatggag
cagagggactacgactcccgaacagcgttacacgtggcagctgcagaagggcacgtggat
gttgtgaagttcctgctggaagcatgcaaagtgaaccctttccccaaagacagatggaac
aacactcctatggatgaagctttacattttggacaccacgatgtatttaaaattcttcag
gaatatcaggtccaatacacgccgtcagaggattccaacaacggaaaggagaaccgaacg
gttcataaaaacctggatggtttactataa

DBGET integrated database retrieval system