KEGG   Anas platyrhynchos (mallard): 101804004Help
Entry
101804004         CDS       T02816                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
apla  Anas platyrhynchos (mallard)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MPYSTSSSDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPA
GSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAM
KGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGP
IDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQRQLAEE
EPMDTDQSSNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAE
HQQLIPLVEKAKEKQNAKKVQEAK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccttacagcacaagctccagcgaccccggcgtcttcaccgagctcatcaagggcttc
ggttgtagaggagcacaagttgaagaaatttggagcttggagccagaaaattttgaaaaa
ctgaagccagtacacgggctcattttcctattcaagtggcagcctggagaggaaccagca
ggttctgttgttcaggattccagactggatacaatattttttgctaaacaggtaataaat
aatgcttgtgctactcaagccatagtgagtgtgctattaaattgcgctcatcaagacatc
catctaggagagactttgtcagaatttaaagaattttcacaaagttttgatgctgcgatg
aaaggtttggcactaagcaactcagaagtgattcggcaagtgcacaacagttttgccaga
caacagatgtttgaatttgatgcaaagtcttcagcaaaagaagaagatgcgtttcacttt
gtaagctatgttcctgttaatggacggctatatgaactagatggattaagggaaggacca
attgatttaggtgcgtgcaatcaagatgactggataagtgctgtacggcctgtcatagag
aaacgtatacaaaaatacagtgaaggcgagataaggtttaatttgatggctattgtgtct
gacagaaagatgatatatgaacagagaattgcagaattacagcggcaacttgcagaggag
gagcctatggatacagatcaaagcagtaacatgttaagttctatacagtcagaggttgca
aaataccagatgttaattgaagaagaaaaccaaaaattaaaaagatataagattgaaaat
attagaagaaaacataactacttacctttcatcatggaattattgaagactttagcagaa
caccaacagttaataccattagtagaaaaagcgaaagaaaaacagaatgccaagaaagtt
caggaggccaagtga

DBGET integrated database retrieval system