KEGG   Anas platyrhynchos (mallard): 101804710Help
Entry
101804710         CDS       T02816                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101804710
Enzymes [BR:apla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101804710
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101804710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 226 aa AA seqDB search
MDAEKTPGYWNEGARRRLEAALALQPAAQRAKNIILFVGDGMGLPTVSAARIYKGQLAGG
SGEESVLAMETFPHVALAKGSCSTLSRAAGKSVGIVTTTRVQHASPGAAYAHSVSRSWYA
DADMPKEALRDGCKDIAHQLVHNTDINVILGGGRVYMAPRGTPDPEYPEDPWLSTKQGAR
YVWDKKGLDAVDEDSVSHLMGLFEPKDMKFELNRNASTDPSIVEMT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgagaagaccccgggatactggaacgaaggagccaggaggaggctggaggca
gctctggctttgcagccggctgcccagcgagccaaaaacatcatcctcttcgtgggtgac
ggcatggggctgcccacggtgtcggcagctcggatctacaaggggcagctggccggcggc
tcgggcgaggagagcgtcttggccatggagacctttccccacgtggccttggccaagggt
tcctgttcaaccctgtcccgtgctgcaggcaagtccgtgggcatcgtgacgaccacacgg
gtgcagcacgcgtcccccggggcagcctacgcgcactcagtcagccggagctggtacgcc
gacgccgacatgcccaaggaggcgttgcgggacggctgcaaggacatcgcccaccagctg
gtgcacaacacggacatcaacgtgatcctgggcggagggcgggtgtatatggcacccaga
gggaccccagaccccgaatacccggaggacccgtggctcagcaccaagcagggcgcccgc
tacgtctgggacaagaagggcctggatgcagtcgatgaggactccgtgagccacctcatg
ggcctcttcgagcccaaggacatgaagttcgagctgaaccgcaacgcctccacggacccc
tccatcgtggagatgacc

DBGET integrated database retrieval system