KEGG   Anas platyrhynchos (mallard): 101804818Help
Entry
101804818         CDS       T02816                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apla01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apla00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 584 aa AA seqDB search
MLCRAALSPLVRSPGWCFVLPPHAIAAISRFYILRHNQRLRNESIRYWSNIPFITMPLSR
AHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSMLQNQGREMMIV
TSGAVAFGKQRLRHEILLSQSVRQALHSGQSQLKDMAIPVLEARACAAAGQSGLMALYEA
MFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDL
QGVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTF
GTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVK
PAGPTVEQQGEMSRAGGRTLAALQPEQRAEIIYRLADLLTDQREEILLANKKDLEEAENK
GRLALPLLKCLSLSTSKLNSLAIGLRQIAASSQDSVGRIIRRTRIAKDLELEQVTVPIGV
LLVIFESRPDCLPQVCEEGREICDNKSVFLLVSYWKAARSLASKDFCLYSSEMNFVVIPI
FFFYRHILGTCFCNDESYSGLVFDSQHREGVSLHSGGVVSACVL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgagctgctctgagccctcttgtccgttcccctggatggtgctttgtgttg
ccgccacatgccatcgcagccatttcccgtttctatatccttcgccataatcaaagatta
aggaatgaatccatccgttattggagcaacatcccatttatcaccatgccactcagccgt
gcacatggcaaatcatttgcacaccgcagtgagctgaagcatgcaaagcggattgtagtg
aagctgggtagtgctgtcgtgactcgaggagatgagtgtggcttggcccttgggaggctg
gcatctatagtggagcaggtgtcaatgctgcagaatcagggccgagagatgatgattgtt
accagtggtgctgtagcttttggaaagcagcggttgcgtcatgagattttgctttctcag
agtgtgaggcaagcacttcattcaggccagagtcagctaaaagatatggctattccagtc
ttagaggcccgagcctgtgcagcagctggccagagtggactaatggctctgtatgaagcc
atgtttacgcagtatagcatctgtgcagctcaaattttagtcaccaacctggatttccat
gacgaacagaagcgtcggaacttaaatggaacattacatgaacttttaagaatgaatatt
gtccctataattaatactaatgatgctgttgttccacctccagagccgaacagtgatctg
cagggggtgattagtgtgaaggataatgacagtctggcagcacgactggctgttgaaatg
aagactgatctcctgattgttctctcagatgtagaaggactctttgacagccctccagga
tctgatgatgcaaagctcattgacatattctacccaggagaccaacaatctgtgacattt
ggaaccaaatcccgggtgggaatgggaggcatggaagccaaggtgaaagcagctctgtgg
gccctccaaggaggcacctctgtagtgattgcaaatggaacgcacccaaagatctcaggt
catgtcatcacagatattgtggaagggaagaaagttggaacttttttttcagaggtaaaa
cctgcaggccctacagtagagcagcagggtgaaatgtctcgcgctggtggcaggaccctg
gcagctctgcagcctgagcagagagcggagattatttatcgtcttgctgacttattaact
gatcagagagaagaaattctcttggcaaacaaaaaggacttagaagaagctgaaaataaa
ggaagattggcacttcctttgttgaaatgtctaagtctgtctacatcaaagctgaacagc
ttggctattgggctacgtcaaattgcagcatcttcacaggacagcgtcggccgcataatt
cggagaacacgaatagcaaaggatctagagttggagcaggtgacagtgcctattggggtc
cttctcgtgatttttgagtcccgtcctgactgtcttccacaggtatgtgaggagggcaga
gagatctgtgataacaaaagtgtatttctattggtgagttattggaaggctgcaagaagt
cttgcctcaaaagacttttgcttgtattcctctgaaatgaattttgttgtcatcccaatt
ttttttttctacagacacattcttgggacttgcttctgcaatgatgaaagttattcaggg
ttggtttttgatagccaacatagagaaggagttagcttacattcaggtggtgtggtttct
gcatgtgtcttataa

DBGET integrated database retrieval system