KEGG   Anas platyrhynchos (mallard): 101805408Help
Entry
101805408         CDS       T02816                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101805408 (ART4)
Cellular antigens [BR:apla04090]
 Proteins
  101805408 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 307 aa AA seqDB search
MSWVDSRMSVHLLASLLLLISLQRLSVSQLMMDMALHSFDDQYLGCREQVMEELERGDYF
HKEIAANKNYFSLWKKAQEALLKSPVGLLREMQESHAIVLMAYTMNSSLHSQLNWATSTA
GSSPEQYRHNFSFKYFHFYLTTAIQIVKQWQSSKENMRKHKCYRVHRGVKDLHIEAMVGR
RVRFGRFTSTSRLWNEAQKFGNETLFTVTTCLGAALQGFSYYTSEKEVLIPPYEVFIVKN
FFRTEYGNRLHLHSVGNFSKYHCQLLEDARRYGVQISKRTTERTRSSYCRYVLYGHAQTF
LKLAIEG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggtggactctaggatgtcagtacatctgctggccagccttctgttgctgatc
tccttgcaaagactgtctgtgtcccaacttatgatggatatggctctacattcctttgac
gatcagtacctggggtgcagagagcaggtgatggaagaactggagagaggagactatttc
cataaggaaatagctgctaataaaaactatttcagtctttggaagaaggctcaggaggct
ttgttaaagagccctgtaggtctcttaagggaaatgcaggagagtcacgccatagtcctc
atggcttacaccatgaattcttccctgcactctcagctgaactgggccacatccacagca
ggaagctctccagagcagtacagacacaacttcagtttcaaatattttcacttttaccta
acgactgctatccagatagtgaagcaatggcagagcagcaaggagaacatgaggaaacat
aagtgctaccgagtgcataggggtgtaaaagacttacatattgaagccatggtaggcaga
agagtgcgatttggccgtttcacctctacatctcgcctctggaatgaagcccagaagttt
ggaaatgaaactttgttcacagtgacaacttgcctgggagcagctctgcaaggcttttct
tactacacatctgagaaggaagtcctcattcccccttatgaggtgttcattgtcaaaaac
ttcttccggacagagtatggcaaccggctgcacctgcattctgtggggaatttcagcaag
taccactgccagctcttggaagatgctcggagatacggagtacagatttcaaaaagaact
acagagagaaccagaagcagctactgcagatatgtgctgtacggacatgctcaaactttc
ctcaaacttgccatcgagggttaa

DBGET integrated database retrieval system