KEGG   Anas platyrhynchos (mallard): 101805426Help
Entry
101805426         CDS       T02816                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101805426 (KAT2B)
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101805426 (KAT2B)
Transcription machinery [BR:apla03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101805426 (KAT2B)
Chromosome [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101805426 (KAT2B)
   HAT complexes
    PCAF complex
     101805426 (KAT2B)
    STAGA complex
     101805426 (KAT2B)
    TFTC complex
     101805426 (KAT2B)
    SAGA complex
     101805426 (KAT2B)
    SLIK complex
     101805426 (KAT2B)
    ADA-HAT complex
     101805426 (KAT2B)
    HAT-A2 complex
     101805426 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 739 aa AA seqDB search
MAWVLGGREAEESCKCNGWKNPNPPPTPPRADLQQTVVSLTEPCRSCSHTLAAHVSHLEN
VSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLES
PPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPSQRRLRSPND
DIAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDK
LPQEKRTLILTHFPKFLSMLEEEVYSPNSPIWDQDFIVSTSRTGQLGIQTVINPPPVARS
VSYSASPSSLEQPNSGNMSPACKVSSVLDPNLGEKRKNNEPYSLEDSKRPRIVGDIPIEL
INEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMM
WLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVF
CAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKY
VGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKD
GVRQIPIESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFMEPVK
RTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCA
NILEKFFYTKIKEAGLIDK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggtgcttggtggcagagaggctgaggaatcttgtaaatgcaatggctggaag
aaccccaacccacctcccactccccctcgggcagatctgcagcagacagttgtcagcctt
actgaaccatgccgcagctgcagccatacactagctgctcatgtttctcacctggagaat
gtgtctgaagaagaaatgaataggctactggggattgtactggatgtggagtatctgttc
acctgtgtccacaaggaagaagatgcagacaccaagcaagtttatttctacttgttcaaa
cttttgaggaagtgcatattacagatgggaaaacctgtagtagaaggatctttggaaagt
cccccatttgagaaacctagcattgaacagggtgtgaataattttgtgcagtacaaattt
agccacttaccttcaaaggaaaggcagacaatagtggaactggctaaaatgtttctgaac
cgcattaactactggcacctggagacaccttctcagcggagactacgatcacccaatgat
gatattgcaggatataaagtgaattacaccaggtggctttgttattgcaacgtccctcag
ttctgtgacagtctacctcggtatgaaaccacacaggttttcggtaggacgttgcttcgc
tccgtttttactgtaatgagacggcagctgctggaacaggccaggcaagaaaaagacaag
cttcctcaagaaaaacgaacactaatcctcacccatttcccaaagtttctgtcaatgctg
gaagaagaagtatatagcccaaattcgcctatttgggatcaggatttcattgtgtctact
tcccgaactggccaactgggaatccagacagttattaatcctcctcctgttgcaagatct
gtttcgtacagtgcaagtccttcatctctggagcaaccgaacagtggaaacatgagtcct
gcttgcaaagtttcttctgtccttgacccaaacctaggggaaaaaagaaaaaataatgaa
ccttattctctggaggattcaaaaagaccaagaattgtaggagatattcctattgagtta
atcaatgaagtcatgtcaacaattacagatccagcagcaatgcttgggccagagaccaac
ttcctctcagcacattcggcccgggatgaggcagcgagactggaggagcgcaggggagtg
atagaattccacgtggttgggaactccctgaaccagaagccaaacaagaagatcatgatg
tggctggttggtttgcagaatgtattttcccatcagctgcctcgaatgccgaaggagtac
atcacgcgcttggtctttgatccgaaacacaagacccttgcattaataaaagatggtcgt
gttattggtggtatctgcttccgaatgttcccctcccaaggatttacagagatcgttttc
tgtgctgtgacttccaatgaacaagttaagggttatggaactcacttaatgaaccatctg
aaggagtaccacatcaaacataacatcctcaacttcctcacatatgcagatgaatatgct
attggctacttcaaaaaacaaggtttctccaaagatattaaagtaccaaaagcaaaatat
gttggctacatcaaggattatgaaggtgccacattaatgggatgtgaactaaatccaagg
atcccctacacagaattttctgttattattaaaaagcaaaaggagatcattaaaaagctc
atagaaaggaaacaagctcagattcgaaaagtttatcctggcctttcttgcttcaaagat
ggagtacgacagattcctatagaaagcattcctggaataagagagactggctggaaacca
agtggaaaagaaagaggtaaagagcccaaggatcctgaccaactttacagcacattaaaa
actatcctgcaacaagtgaagagccatcaaagcgcttggcccttcatggaacccgtgaag
agaacagaagctcctggatattatgaagttataaggtttcccatggatctcaaaacaatg
agtgagcgactcaagaataggtactacgtgtctaagaaattattcatggcagacttgcag
cgagtctttacaaattgcagagagtacaacccccccgagagtgaatactacaaatgtgcc
aatatactggagaaattcttctatacaaaaattaaagaagctggattaattgacaagtaa

DBGET integrated database retrieval system