KEGG   Acanthaster planci (crown-of-thorns starfish): 110979480Help
Entry
110979480         CDS       T05078                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110979480
Peptidases [BR:aplc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   110979480
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110979480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 398 aa AA seqDB search
MAPKRRNLVKNTSNGEASNGNSTAVTVRRKGTGLRTHVATCTSPPLVSTVARENAGLKSP
CTTGNGRSKPLSWKMAVKTSALCCVCVYILVPVLAPIVPFITKQFLYLCLVKNPLSPSLQ
YPEKQHITGARNVHIGTIPHDAGIQLGLWQMLPRSLQTDSIHHNSQFDAALGDGKPIILY
LHGNAGSRAADHRLLLYRLLTGMDFHVVALDYRGFGDSSGWPTAEGVVNDAESAYRWVEE
RSKDAPIYVWGHSMGSGIGSAMVKRLCKSGLCPHGVILESPYNSMHDAMINHPFTMPWWV
LPGFLAMVSKAYEQEEAMFNTQENLLEVSCPILIIHAEDDFVVPFKLGKRLYDYSVEHRD
KSLPMVTFQSFGYDGFGHRHIVDSPDLPTVIRNFMKQC
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaacggagaaatcttgtgaaaaacacatcaaacggtgaggctagcaacggc
aactccacggccgtgacggtgcgcaggaaaggcaccggcttgcgcacacatgtagctaca
tgtacatctccccctcttgtctcgacagtggcgagagagaacgcgggtttgaagagccca
tgtactactggcaatggcaggtcaaaaccactgtcatggaagatggctgtcaagacgtca
gcgttgtgctgtgtgtgcgtatatattctggtaccagtgttagcccctatcgtacctttc
ataactaagcagtttctttacctttgcctggtcaagaaccccctgtcaccttctttgcaa
taccccgagaagcagcacatcacaggggccagaaatgttcacataggcactataccccat
gacgccggcatccagttgggcctgtggcaaatgttacctcgatcccttcaaactgacagt
atacaccacaacagtcaatttgatgcagcactgggagatggcaaaccgataattctctat
ctccatggcaatgcaggatccagagctgcagatcatcgtctgctgttgtacagacttttg
acaggaatggacttccacgtcgtggccttagactaccgaggttttggtgattccagtggc
tggcctacggcagagggagtggtgaatgatgctgagtctgcctacagatgggtggaggag
agaagcaaggatgcgcccatctatgtctgggggcactccatgggtagtgggattggaagt
gcaatggtgaaaagactgtgcaaatcaggcttgtgcccacacggtgtaatcttagagtct
ccctacaacagcatgcatgatgccatgatcaaccaccccttcaccatgccatggtgggtc
ctaccagggttcttggcaatggtcagtaaggcctacgagcaagaggaggcaatgttcaac
actcaggagaacctcctggaagtcagctgcccaattctcatcatccatgcagaagatgac
tttgtcgtccctttcaagttgggcaagagactctatgactacagtgttgagcatcgtgac
aagtccctacccatggtgactttccagtcctttgggtacgacggctttggacaccggcac
attgtggactccccggacttgcccacggttatcaggaacttcatgaagcagtgctga

DBGET integrated database retrieval system