KEGG   Alpha proteobacterium HIMB5: HIMB5_00000170Help
Entry
HIMB5_00000170    CDS       T02250                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00020  Citrate cycle (TCA cycle)
apm00640  Propanoate metabolism
apm00660  C5-Branched dibasic acid metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01130  Biosynthesis of antibiotics
apm01200  Carbon metabolism
Module
apm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB5_00000170
   00640 Propanoate metabolism
    HIMB5_00000170
   00660 C5-Branched dibasic acid metabolism
    HIMB5_00000170
Enzymes [BR:apm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HIMB5_00000170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A PM0188
Motif
Other DBs
NCBI-ProteinID: AFS46790
UniProt: J9YUP6
Position
16474..17634
Genome map
AA seq 386 aa AA seqDB search
MNIHEHQAKQILEKYGAPVPKGVFGLSVNEAVEKAKNLETKKYVLKAQIHAGGRGKAGGV
KILDSLQELEKAANELFGKTLVTHQTGPEGREVKRLYIEESSEIDKEFYLSCLVDRASSK
IAFISSDQGGMDIEEVASKTPEKIITTKVDFNDDISDKDCEEIIKIFDLKDSAQNQGISL
IKAIYKMFVNTDANMVEINPLILTKDNKIICLDAKVNFDDNALFRHPEILELRDLNEEDP
TEIEASKHELAYIKLDGSIGCMVNGAGLAMATMDIIKLYGKEPANFLDVGGGASKEKVAA
AFKIILSDKNVKGILINIFGGIMRCDVLAQGVVDAAKEINISVPLVVRLAGTNFKEGKEI
LDSSGLKIISANDLDDAAKKIVEAIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagcatcaagcaaaacaaattttggaaaaatatggagcaccagttcca
aaaggtgtttttggtttaagtgtcaatgaagctgtagagaaagcaaaaaatcttgaaaca
aaaaaatacgtattaaaagcacaaattcatgctggtggcagaggtaaagcaggtggagtt
aaaatattagatagcctacaagagcttgaaaaagctgccaatgaattatttggaaaaact
ttggttacacatcaaactggtccagaaggaagagaagtaaaaagattatatatagaagaa
tcatctgaaatagataaagaattttatctttcatgcttagtagatagagcaagttccaaa
attgcttttatttcaagtgatcaaggtggaatggatattgaagaagtagcaagcaaaact
cctgaaaaaataattacaacaaaagtcgattttaacgacgatatttcagataaagattgt
gaagaaattataaaaatctttgatttaaaagatagtgcacaaaatcaagggataagttta
ataaaagctatttacaaaatgtttgttaacacagatgcaaacatggttgaaataaatcct
ctcatcttaacaaaagacaataagattatttgtttagatgcaaaggtaaattttgacgat
aatgctttatttagacatcctgagattttagaactaagagatttaaatgaagaagatcct
actgaaatagaggcaagtaaacacgaactagcttatattaaattagatggaagtattgga
tgtatggttaatggcgcaggcttagccatggctacaatggatataattaaattatatggt
aaggaacctgcaaattttttagatgtggggggtggagcttcaaaagaaaaagtggcagca
gcatttaaaataatcttatctgataaaaatgttaaaggtattttgataaatatctttggt
ggaataatgagatgtgatgttcttgctcaaggagtcgtagatgcagcaaaagaaataaac
atatctgttccattagttgtaagattagcaggaaccaatttcaaagaaggtaaagaaata
cttgatagctctggcttaaaaattatttctgcaaacgatcttgatgatgctgcaaaaaaa
attgtagaggcaattaagtaa

DBGET integrated database retrieval system