KEGG   Alpha proteobacterium HIMB5: HIMB5_00000200Help
Entry
HIMB5_00000200    CDS       T02250                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:apm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:apm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21442..22728
Genome map
AA seq 428 aa AA seqDB search
MSEKIVVPVLGESITEATVAKWLKKEGDHVEADEPIVELETDKVNLEVPSPIDGVLSEIV
SKDGSTVEVGALLGSISQNGSATSPKQPQVKKEPEIKKENNVVNLETPKKKEIKVEKQKE
EDAPLRLTKEVKKPKSPTNLNNSKQVLSPAVRKMVEEKKIDLSRVRGSGKDGRVLKGDLI
SLMGANPPPSERKAQFGEEERIKMSRLRLTIAKRLKQAQENAALLTTFNEVDMTGIMEMR
KENQEDFQSRYGIKLGFMSFFVKACVAALKTFPAVNAEIDGEEIIYKNYYNISFAVGTDK
GLVVPVLRNADELSFADIEKDIKVISEKARDGKLTIEDLQGGTFTISNGGVYGSMLSTPI
LNLPQSGVLGMHNIVERPVVVDGEIKIRPIMYLALSYDHRIIDGKESVSFLKMVKENLED
PRRLFLDI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaattgtcgttcctgttttaggcgaaagtattactgaagccaccgttgct
aaatggttaaaaaaagagggtgatcatgttgaagcagatgagcctatcgtagaattagaa
acggataaagtaaatttagaagtgccttcaccaatagatggtgttttaagtgaaatagtt
tcaaaagatggatcaacagttgaggttggggctttattagggtctattagtcaaaatgga
tctgctacatctccaaaacaaccccaagtaaaaaaagaaccagaaattaaaaaagaaaat
aatgttgttaatttagaaacaccaaagaaaaaagaaattaaggtagaaaaacaaaaagaa
gaagatgctcctttaagattaacaaaagaggttaaaaaaccaaaatctccaacaaattta
aataattctaaacaggttttatctccagcagtgagaaaaatggtagaagaaaaaaaaatt
gatctaagtagagtaagaggttctggaaaagatggaagagttttaaaaggagaccttatt
agtttgatgggggcaaacccaccaccttctgaaagaaaagctcaatttggtgaagaagaa
agaatcaaaatgagcagactaagattaactatagcgaagagattaaagcaggctcaagaa
aatgcagcattgttaactacattcaatgaagttgatatgacaggcataatggaaatgaga
aaagagaatcaagaagattttcaaagcagatatggaattaaattaggatttatgtcattt
tttgtaaaagcttgtgtggcagctttaaaaacattcccagcagtaaatgcagaaattgat
ggagaggaaatcatttataagaactactacaatattagttttgctgttggaacagacaaa
ggacttgtagtgccagttttaagaaatgcagacgaactatctttcgcggacatcgaaaaa
gatattaaagtaatttctgaaaaagctagagatggaaaattaacgattgaggatttacaa
ggtggtacatttacaatcagtaatggaggtgtatatggatcaatgctatcaacaccaata
ttaaatttgcctcaatctggagttctaggaatgcacaatattgtagaaagacctgttgtt
gtagatggggaaattaaaataagaccaattatgtatttagcgttatcttatgatcacaga
attattgatggaaaagaatcagtctcttttttaaaaatggtaaaagagaacttagaagat
ccaagaaggttatttttagatatttaa

DBGET integrated database retrieval system