KEGG   Alpha proteobacterium HIMB5: HIMB5_00000510Help
Entry
HIMB5_00000510    CDS       T02250                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51523..52449)
Genome map
AA seq 308 aa AA seqDB search
MNGKIEKEKISQKYLIKLKYLSNKKGFLGVDNKFNFREKVVIVPFGLEKTVSYGGGTKNG
PKEIIKASHQVELYDEELNCEPYKKIGIKTLETFKIDKNINKALKKMASVNKEILDKKLF
PMTFGGEHSITPGCIDPFVKKYKKICLLHFDAHADLRDSYNGEKFSHASAIRRCLDHKNV
SIISFGIRNISESEIPFLKKNKFRINIFWAKDKPRWDLKKFKKLIKNKTVYLTFDVDGLD
SSIMPATGTPEPGGLLWDETLNIIRIAAKNSNIVGADINELAPIKGFNSYNFLVAKLAYK
ILSYKFFY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggaaaaatagagaaagaaaaaatttctcaaaaatatttaattaaattgaaatat
ctttcaaacaaaaaaggatttcttggagttgataataaattcaattttagagaaaaagta
gttatagtcccatttggacttgaaaaaactgttagctatggtggtggtactaaaaatggc
ccaaaagagattattaaagcatctcatcaagttgagctttatgatgaagagctcaattgt
gaaccctacaaaaaaataggtattaaaacattagagacttttaaaattgacaaaaatatt
aataaagccttaaaaaaaatggctagtgttaataaggaaattttagataaaaaacttttt
cctatgacctttggtggtgaacattctatcactcctgggtgtattgatccatttgtaaaa
aaatataagaaaatttgtctgttacattttgatgctcatgctgatcttcgagatagctat
aatggagagaagttttctcacgcatcagctatcagacgttgtttagatcacaaaaatgta
tctatcatatcattcggaattcgtaatatttctgagagtgaaataccttttttgaaaaaa
aataaattcagaataaacattttttgggcaaaagataaacctagatgggatttaaaaaaa
tttaagaaattaattaaaaacaaaactgtttatcttacatttgatgtggatggtctagat
tcgagtattatgcctgctactggtactcctgagccaggtggtttattatgggatgaaact
ttaaatatcataagaatagcagcaaaaaattctaatatagttggtgctgatattaatgag
ctagcaccaataaaaggatttaattcttataattttttggtagctaaactagcttataaa
atattgtcttataaatttttctactaa

DBGET integrated database retrieval system