KEGG   Alpha proteobacterium HIMB5: HIMB5_00001230Help
Entry
HIMB5_00001230    CDS       T02250                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB5_00001230
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00001230
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HIMB5_00001230
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HIMB5_00001230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118024..119406
Genome map
AA seq 460 aa AA seqDB search
MKYISTRDKSKEFEFKDVFLKGLADDGGLFIPKNLKKFTEKELNEFSNLNYIELANKIIA
PFVDDFVSGKDLEDLISKSYSTFREKNVVKLINVGDRKVLELFHGPTLAFKDVAMQLLGN
FYEYYLSKEDDKINIVVATSGDTGAAAIEAIRGKKNINIFVLHPHNRVSPVQRKLMTTAK
DKNVHNIAINGNFDDCQNLVKSMFADHNYAKSIRMSGVNSINWARIIAQSVYYFYSFYLV
KNDKGPINFSVPTGNFGDVYAGYLAKKMGLQIGKLIVATNQNDILHRAISSGQYYSEKVQ
ETNSPSMDIQIASNFERLIFDLNNEDDHETSSVMQKIKSEKKYDLDQSKLDKIRKDFSSS
SADEKKVISLIKKVYESHKEILDPHTAIGYGGFDDVELEGTNIVLSTAHPCKFPDAIFNA
INIKPDLPDELKYISNEKENFDLLDNDINIVKQHIKEKIQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacataagcactagagataaatcaaaagagtttgaatttaaggatgttttctta
aaaggattagccgatgatggggggctatttattccaaaaaaccttaaaaaatttactgaa
aaagagttaaatgaattttcaaatttaaattacattgaattagctaataaaattattgca
ccatttgtagatgattttgtttctggaaaagatctagaagatttgatctctaaatcatat
tcaacttttagagaaaaaaatgtcgttaaattgattaatgttggcgatagaaaggttttg
gaattattccatggtcctactttagcatttaaagatgtcgcaatgcagcttcttggaaat
ttttatgaatattatttgtcaaaagaggacgataaaataaatattgtagttgctacttct
ggcgacacaggtgctgctgccatagaagcgattagaggaaagaaaaatattaatatattc
gtactacaccctcataatcgtgtttctccagttcaaagaaaattaatgacaactgctaag
gataaaaatgtacataatattgcaatcaatggaaattttgatgattgtcaaaatttagta
aaatcaatgtttgcagatcataattatgcaaaatcaatcaggatgtcaggtgttaattcc
attaattgggcaagaattatcgcacaatctgtatattatttttattccttttatttggta
aaaaatgataaaggacctattaacttttcagtacccacaggaaattttggtgatgtttat
gcaggctatcttgcaaaaaaaatgggattacaaattggtaaattgattgtagcaacaaac
caaaatgatattttgcacagagcgataagttcggggcaatattattcagaaaaggtacaa
gaaactaactcacctagtatggatattcaaattgcaagtaactttgaaagattgattttt
gacttaaataatgaagacgatcatgaaacaagttcagttatgcaaaaaattaaaagtgaa
aagaaatacgatttagaccaatctaaactagataaaataagaaaagacttttcatcctca
agtgcagatgaaaaaaaagtaatttcattaataaaaaaagtttatgaaagtcataaagag
attctagaccctcacactgcgataggttatggaggttttgatgatgtagaacttgaagga
acaaatattgttttatctacagctcatccttgtaaatttccagatgctatatttaatgca
ataaacattaaaccagatttaccagatgagcttaagtatatttcaaatgaaaaagaaaat
tttgatttacttgataatgatattaatatagttaagcagcacattaaggagaaaattcaa
tga

DBGET integrated database retrieval system