KEGG   Alpha proteobacterium HIMB5: HIMB5_00002920Help
Entry
HIMB5_00002920    CDS       T02250                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00230  Purine metabolism
apm01100  Metabolic pathways
Module
apm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HIMB5_00002920
Enzymes [BR:apm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HIMB5_00002920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_33 ABC_tran Rad17 RsgA_GTPase Thymidylate_kin AAA_22 cobW AAA_16 AAA TsaE Cache_3-Cache_2 CPT AAA_29
Motif
Other DBs
NCBI-ProteinID: AFS47061
UniProt: J9YVR6
Position
281263..281895
Genome map
AA seq 210 aa AA seqDB search
MPLKDDGIMVILSSPSGAGKTTLVKLLSEKDKFNISISHTTRKPRDKEIPNKDYYFVDEE
EFKRLINNEEFLEYAKVFNNLYGTTRSPVINKLQNGENVIFDIDWQGADQIKNKRLDYKL
ITFFILPPSREILFKRLSNRDMKDKLIAEERMKEFNRDVLHWINYDYVIINDDLEKCYNK
IKNLISAELNNGPKDYDKEYIRDHVERLTS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcccttaaaagatgatgggattatggtaatattatcatccccatctggggctggtaaa
acaacattagttaagcttttatccgaaaaagataagtttaacatatcaatatcacacaca
acacgtaaacctcgcgataaagagatacctaataaagactattactttgttgacgaagaa
gaattcaaaagattaataaataacgaagagtttttagaatacgcaaaagtttttaacaat
ctttatggaactacaagaagtccagtaataaataaacttcaaaatggagaaaatgtaatt
ttcgatatagattggcaaggtgcagatcaaattaagaacaagagattagattataaatta
attactttttttatcttaccacctagcagagaaatattgtttaaaagattatcaaatcga
gatatgaaagataagctaattgctgaagagagaatgaaagaatttaatagagatgtactt
cattggataaattatgactatgttattatcaacgatgatttggaaaaatgttacaataaa
ataaaaaatttaattagtgctgagcttaataatggaccaaaagattatgataaagaatat
ataagagatcatgtcgagcgtttaacttcttaa

DBGET integrated database retrieval system