KEGG   Alpha proteobacterium HIMB5: HIMB5_00003670Help
Entry
HIMB5_00003670    CDS       T02250                                 

Definition
short chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:apm00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:apm00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347102..347845
Genome map
AA seq 247 aa AA seqDB search
MGNRLQGKIALVTAAGQGIGKATAISFFNEGAKVIATDINEKTLNELKKEYPDIEVIKLD
STDTNAVQNTLDKINKIDILFNAVGFVHHGTILECEEKDWDFSFDVNIKSMYFMCRSVLP
IMLKNNGGSIINISSVVSSIKGLPNRFVYGVTKAAIIGLTKSIASDFVKKNIRCNAIAPG
TVFTPSWEDRVKQSPDPVKAKKDFIARQPMGRLGTAQEIADFAIYLASDESTFTTGNTFS
VDGGMTI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatagattacaaggcaaaatagctttagttacagcagcaggacagggaattgga
aaagcaacagctataagtttttttaatgaaggtgcaaaagtgattgccacagatatcaat
gaaaaaactttaaatgaattaaaaaaagaatatcctgatatagaagttataaaattagac
tctacagacacaaatgcagttcaaaatactttagataaaattaacaaaatagatattttg
tttaatgcggtaggttttgttcatcatggaactattttagaatgtgaagagaaagattgg
gatttttcttttgatgtgaatattaaatctatgtattttatgtgtagatctgtacttcca
attatgcttaaaaataatggtggaagtataattaatatatcatctgtagtgtccagtata
aaaggcttaccaaatagatttgtttatggggtaacaaaagcagcaataatcggactaact
aaatcaatagcatcagattttgttaaaaaaaatattagatgtaacgcaattgctccaggt
acagtatttactccttcatgggaagatagagtaaaacaaagtccagatcctgttaaagca
aaaaaagattttattgcaagacaacctatgggcaggttaggaacagcacaagaaattgct
gattttgcaatttatttagcaagcgatgaatcaacctttacaacaggaaatacattttct
gtagatggtggaatgacaatttaa

DBGET integrated database retrieval system