KEGG   Alpha proteobacterium HIMB5: HIMB5_00003670Help
Entry
HIMB5_00003670    CDS       T02250                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00072  Synthesis and degradation of ketone bodies
apm00650  Butanoate metabolism
apm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HIMB5_00003670
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HIMB5_00003670
Enzymes [BR:apm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HIMB5_00003670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR UDPG_MGDP_dh_N TrkA_N 3HCDH_N Methyltransf_25 ATP-synt_10 ADH_zinc_N UAE_UbL CmcI
Motif
Other DBs
NCBI-ProteinID: AFS47136
UniProt: J9YW14
Position
347102..347845
Genome map
AA seq 247 aa AA seqDB search
MGNRLQGKIALVTAAGQGIGKATAISFFNEGAKVIATDINEKTLNELKKEYPDIEVIKLD
STDTNAVQNTLDKINKIDILFNAVGFVHHGTILECEEKDWDFSFDVNIKSMYFMCRSVLP
IMLKNNGGSIINISSVVSSIKGLPNRFVYGVTKAAIIGLTKSIASDFVKKNIRCNAIAPG
TVFTPSWEDRVKQSPDPVKAKKDFIARQPMGRLGTAQEIADFAIYLASDESTFTTGNTFS
VDGGMTI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatagattacaaggcaaaatagctttagttacagcagcaggacagggaattgga
aaagcaacagctataagtttttttaatgaaggtgcaaaagtgattgccacagatatcaat
gaaaaaactttaaatgaattaaaaaaagaatatcctgatatagaagttataaaattagac
tctacagacacaaatgcagttcaaaatactttagataaaattaacaaaatagatattttg
tttaatgcggtaggttttgttcatcatggaactattttagaatgtgaagagaaagattgg
gatttttcttttgatgtgaatattaaatctatgtattttatgtgtagatctgtacttcca
attatgcttaaaaataatggtggaagtataattaatatatcatctgtagtgtccagtata
aaaggcttaccaaatagatttgtttatggggtaacaaaagcagcaataatcggactaact
aaatcaatagcatcagattttgttaaaaaaaatattagatgtaacgcaattgctccaggt
acagtatttactccttcatgggaagatagagtaaaacaaagtccagatcctgttaaagca
aaaaaagattttattgcaagacaacctatgggcaggttaggaacagcacaagaaattgct
gattttgcaatttatttagcaagcgatgaatcaacctttacaacaggaaatacattttct
gtagatggtggaatgacaatttaa

DBGET integrated database retrieval system