KEGG   Alpha proteobacterium HIMB5: HIMB5_00004390Help
Entry
HIMB5_00004390    CDS       T02250                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00004390
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HIMB5_00004390
Enzymes [BR:apm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HIMB5_00004390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(407908..409182)
Genome map
AA seq 424 aa AA seqDB search
MSAENISYDLKRFAGIQRDYTPEEVERLRGSIKIEYSMCKHQSQKLWNLLNSEPYVNTLG
SLSGNHAVQHAKAGLKAIYLSGWQVAADANSAGEMYPDQSLYPYDSAPKLVESMNNALIR
ADQIQHMEIQDGDMKKENKVDYMLPIIADGEAGFGGPLNVFELAKKFIKAGAAGVHFEDQ
LASEKKCGHMGGKVLVPTGTMVKNLKAARLAADIADVPLIILARTDANAAKLITNDHDAN
DKPFLTGERSPEGFYYVKHGIDQAISRGLAYAPFADLIWCETATPNLEEAKKFADAIHAK
YPGKLLAYNCSPSFNWKKHLSDAEIATFQQEIGKMGYKFQFITLAGFHTQNIAIFELAEK
YKTEGMTAYSRIQQQEFAREKDGYTSVKHQREVGTSYFDAVSNTISSGQSSTTAMSGSTE
EEQF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaaatatatcatacgatctaaaaagatttgccggtatacaaagagattat
acacctgaagaagttgaaagactaagaggttcaattaaaattgaatactcaatgtgtaaa
catcagtctcaaaagttatggaatttattaaactctgagccttatgttaatactttagga
tcattatctggaaatcatgcagttcagcatgcaaaagcagggctaaaagcaatttattta
agtggatggcaggtagctgcagatgcaaatagtgctggtgaaatgtaccctgatcaatct
ttatatccttatgacagtgctccaaaattagtagagtctatgaacaatgctctaattaga
gcagaccaaatccaacatatggaaattcaagacggtgacatgaaaaaagaaaataaagtt
gattacatgttaccaattattgcagatggtgaagccggatttggtggacctttaaacgta
ttcgagcttgctaaaaaatttattaaagcaggtgctgcaggcgttcactttgaagatcag
ttagctagtgaaaagaaatgtggtcacatgggtggtaaagtattagtgccaacaggaaca
atggttaaaaatttaaaagctgcaagattagctgctgatattgctgatgtaccattgatc
atattagcaagaacagatgcaaatgctgcaaaattaattacaaatgatcatgatgcaaat
gataaaccattcttaactggtgaaagatctccagaaggtttttattatgtaaaacatggt
attgatcaagctatatcaagaggtcttgcttatgcaccttttgcagatttaatatggtgt
gaaacagcaactcctaatcttgaagaagctaaaaaatttgcagatgcaattcatgcaaaa
tatcctggaaaattactagcatataactgctctccatcatttaattggaaaaaacattta
tctgatgcagagattgctacattccaacaagaaattggtaaaatgggatacaaattccag
tttattactcttgcaggatttcatactcaaaacattgcaatatttgaactagcagaaaaa
tataaaactgaaggtatgactgcttactctagaattcaacaacaggaatttgctagagaa
aaagatggttatacaagtgttaaacatcaaagagaagttggtacatcatatttcgatgca
gtttcaaatacgatcagtagcggacaaagttcaacaacagcgatgtcaggatctactgaa
gaagaacagttttaa

DBGET integrated database retrieval system