KEGG   Alpha proteobacterium HIMB5: HIMB5_00004390Help
Entry
HIMB5_00004390    CDS       T02250                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00630  Glyoxylate and dicarboxylate metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HIMB5_00004390
Enzymes [BR:apm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HIMB5_00004390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFS47207
UniProt: J9YW02
Position
complement(407908..409182)
Genome map
AA seq 424 aa AA seqDB search
MSAENISYDLKRFAGIQRDYTPEEVERLRGSIKIEYSMCKHQSQKLWNLLNSEPYVNTLG
SLSGNHAVQHAKAGLKAIYLSGWQVAADANSAGEMYPDQSLYPYDSAPKLVESMNNALIR
ADQIQHMEIQDGDMKKENKVDYMLPIIADGEAGFGGPLNVFELAKKFIKAGAAGVHFEDQ
LASEKKCGHMGGKVLVPTGTMVKNLKAARLAADIADVPLIILARTDANAAKLITNDHDAN
DKPFLTGERSPEGFYYVKHGIDQAISRGLAYAPFADLIWCETATPNLEEAKKFADAIHAK
YPGKLLAYNCSPSFNWKKHLSDAEIATFQQEIGKMGYKFQFITLAGFHTQNIAIFELAEK
YKTEGMTAYSRIQQQEFAREKDGYTSVKHQREVGTSYFDAVSNTISSGQSSTTAMSGSTE
EEQF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaaaatatatcatacgatctaaaaagatttgccggtatacaaagagattat
acacctgaagaagttgaaagactaagaggttcaattaaaattgaatactcaatgtgtaaa
catcagtctcaaaagttatggaatttattaaactctgagccttatgttaatactttagga
tcattatctggaaatcatgcagttcagcatgcaaaagcagggctaaaagcaatttattta
agtggatggcaggtagctgcagatgcaaatagtgctggtgaaatgtaccctgatcaatct
ttatatccttatgacagtgctccaaaattagtagagtctatgaacaatgctctaattaga
gcagaccaaatccaacatatggaaattcaagacggtgacatgaaaaaagaaaataaagtt
gattacatgttaccaattattgcagatggtgaagccggatttggtggacctttaaacgta
ttcgagcttgctaaaaaatttattaaagcaggtgctgcaggcgttcactttgaagatcag
ttagctagtgaaaagaaatgtggtcacatgggtggtaaagtattagtgccaacaggaaca
atggttaaaaatttaaaagctgcaagattagctgctgatattgctgatgtaccattgatc
atattagcaagaacagatgcaaatgctgcaaaattaattacaaatgatcatgatgcaaat
gataaaccattcttaactggtgaaagatctccagaaggtttttattatgtaaaacatggt
attgatcaagctatatcaagaggtcttgcttatgcaccttttgcagatttaatatggtgt
gaaacagcaactcctaatcttgaagaagctaaaaaatttgcagatgcaattcatgcaaaa
tatcctggaaaattactagcatataactgctctccatcatttaattggaaaaaacattta
tctgatgcagagattgctacattccaacaagaaattggtaaaatgggatacaaattccag
tttattactcttgcaggatttcatactcaaaacattgcaatatttgaactagcagaaaaa
tataaaactgaaggtatgactgcttactctagaattcaacaacaggaatttgctagagaa
aaagatggttatacaagtgttaaacatcaaagagaagttggtacatcatatttcgatgca
gtttcaaatacgatcagtagcggacaaagttcaacaacagcgatgtcaggatctactgaa
gaagaacagttttaa

DBGET integrated database retrieval system