KEGG   Alpha proteobacterium HIMB5: HIMB5_00004510Help
Entry
HIMB5_00004510    CDS       T02250                                 

Definition
GDSL-like protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HIMB5_00004510
Enzymes [BR:apm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HIMB5_00004510
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HIMB5_00004510
Lipid biosynthesis proteins [BR:apm01004]
 Fatty acid synthase
  Component type
   HIMB5_00004510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417860..418375
Genome map
AA seq 171 aa AA seqDB search
MAGYGLPKEHHLSLVLENNLKQQGFEIEIINGSVSGSTSSGGLNRAEWSLSEPGIDLMIL
GLGANDMLRGIQPNETQQNLDQIIQIAKNKKIKVIIAGMIAPTTHGETYKNSFDQIYPNL
AKKHNLPLIPFLLEGIALNPKLNQQDGIHPNKDGTVMMSKTLQKSIINNIK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatacggtttacctaaagaacaccatttatcattagttttagaaaataatttg
aaacaacaaggctttgaaattgaaattattaatggaagtgtatctggcagcacatcttct
ggaggtttaaatagagcagaatggagtttatcagaaccaggaattgatcttatgatttta
ggacttggtgcaaacgatatgcttagaggtattcaacctaacgaaacacaacaaaatctt
gatcaaattattcaaattgcaaaaaacaaaaaaataaaagtaattatagcaggaatgatt
gccccaacaactcacggtgaaacttataagaatagttttgatcaaatttatccaaattta
gcaaaaaaacataatttacctttaattccatttttacttgagggaattgctttaaatcca
aaattaaaccaacaagatggcattcatcctaataaagatggtacagtgatgatgagtaaa
actttgcaaaaaagtattatcaataatattaaataa

DBGET integrated database retrieval system