KEGG   Alpha proteobacterium HIMB5: HIMB5_00004540Help
Entry
HIMB5_00004540    CDS       T02250                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HIMB5_00004540
Enzymes [BR:apm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HIMB5_00004540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420340..421251
Genome map
AA seq 303 aa AA seqDB search
MSSISVLGIFVADLVFFGKEIPSKGQSVLGNDYKVGPGGKGSNQAITIAKLGGNVDFITK
IGKDSYGEMALNIYKEANVKTDSVSIDNNYPTGVAGIMVDKQGNNAINVIAGASGKITDQ
DINKNLETIKNSKVFLTQLETPHDVTITALKLAKENDCITILNPAPAREIVESDFKFIDY
FTPNETEAEFYLNQKLSSDDDIKNAASKFLDKGVKNIIITLGEKGAYFANNEQNFFVQSH
NLKEKVIDTTGAGDVFNGALAFSLANDTNIKDAIIFANKVAGISTTRLGAANSVPTLNEV
VSY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaatttcggtccttggtatcttcgttgcagaccttgttttttttggaaaagaa
ataccttcaaaaggtcaatcagtactaggaaacgattataaagttggaccaggtggaaag
ggctctaatcaagcaatcactattgcaaagttagggggcaacgttgattttattactaaa
attggaaaagacagttatggagagatggctttaaatatttataaagaggccaatgttaag
accgactcagtatcaattgataacaattatccaactggtgttgcaggcattatggttgat
aagcaaggaaataatgcaatcaatgttatagcaggcgcttcaggtaaaatcacagatcaa
gatatcaacaaaaatttagaaacaattaaaaattcaaaagtatttttaactcaattagaa
actcctcatgatgtaactataactgctttaaaattagcaaaagaaaatgattgtattaca
attttaaatcctgctcctgcaagggaaattgttgaaagtgattttaaatttattgattac
tttactcctaatgaaacagaagctgaattttatctaaatcaaaaactaagtagcgatgat
gatatcaaaaatgctgcaagtaaatttttggataaaggcgttaaaaatataattataaca
ttaggagaaaagggtgcttattttgcaaataatgaacaaaacttttttgttcaatcacat
aatctaaaagaaaaagtaattgatacaacgggtgctggtgatgtttttaatggtgcgtta
gctttttcattagcaaatgataccaatattaaagatgcaataatttttgcaaataaagtt
gcgggtatatcaactacaagattaggtgcggctaattcagttccaactttaaatgaagtt
gtaagttattaa

DBGET integrated database retrieval system