KEGG   Alpha proteobacterium HIMB5: HIMB5_00004850Help
Entry
HIMB5_00004850    CDS       T02250                                 

Definition
inositol monophosphatase family protein (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:apm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(443040..443816)
Genome map
AA seq 258 aa AA seqDB search
MNIEEAKKITKSLIDTFYAAGDLALSIREKGLKKEIKSDNTPVTNGDIEVNKVLTKKIKE
ITPNIPIVSEENSENKENKSLKDFWLIDPIDGTRDYLNNRDEFTLNASLIINNKPLIGLI
NAPAKKRMFYAYAKSHSYEVTNGQEISLSSKIKSNDEITAVSYSKELKPEIFEIHKRYKV
SSHQKMKSSLKFCVIAAGEFDLYVAEPRACEWDIAAGHALIIHSGGSITDFANNEIIYGK
KDFKNTSIIVKNKNLNNG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaagaagcaaaaaaaattacaaagtcattaattgatacattttatgctgcg
ggcgatcttgcattatcaataagggaaaaaggtcttaaaaaagaaattaaatctgacaac
acacctgttacaaatggagatattgaggtaaataaagttttaactaaaaagattaaagaa
ataacaccaaatatccctatagtatctgaagaaaattccgaaaataaagaaaacaaaagt
ttaaaagatttttggttaattgatccaatagacggaacaagagattatctaaataataga
gatgagtttactttaaatgcaagtctaataattaataacaagcctttaataggcttaatc
aatgcgcctgcaaaaaaaagaatgttttatgcatatgcaaaatctcattcttacgaagta
actaatggacaagaaatttcattgtcttcaaaaattaaatctaatgatgaaattactgcc
gtaagttattccaaagaattaaaaccagaaatttttgaaattcacaaaagatataaagtt
tcttctcatcaaaaaatgaaaagttctttaaaattttgtgtgattgctgctggtgaattt
gatttatacgtggcagaaccaagagcgtgtgaatgggatattgcagcaggtcacgctcta
ataattcattcagggggatcaatcactgattttgctaacaatgaaataatttatggtaaa
aaagacttcaaaaatacaagtataattgtaaaaaataaaaacttaaacaatggatga

DBGET integrated database retrieval system