KEGG   Alpha proteobacterium HIMB5: HIMB5_00005690Help
Entry
HIMB5_00005690    CDS       T02250                                 

Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase family protein (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIMB5_00005690
Enzymes [BR:apm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HIMB5_00005690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518922..519809
Genome map
AA seq 295 aa AA seqDB search
MSSISGLDGLIPTIEIIKMTKKIAIANKESIICGWSLLRKELAKHKAIFIPVDSEHFSIH
DLIKNENKSDIKKIFITASGGPFLNHNLKLIKKTNPKNAIKHPTWKMGKKISIDSATLMN
KVFELIEAIKIFDIKKSNFKIIIEPSSYVHAIVEFKNGVTKFLTHPTSMQIPIYNSLYNV
NHNFKFEKINLNKLNKLNFQNIDFKRFPINKILNQIIDNDSLFDTVLITANDTLVDLFLK
KKISFYEIYEKLNTILNLKEFNILKSIRPKNISQITDISHKVRLKTQSLSVRSRI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatcagcggtttagatggcttgataccgacaatagaaattattaaaatgaca
aaaaaaattgctatcgctaataaagaatcaattatttgtggttggtcattattaagaaaa
gaacttgcaaaacataaagcaatttttattcctgtagactcagaacatttttcaatacat
gatctgattaaaaatgaaaataaatcggatataaaaaaaatattcattactgcatctggt
ggaccttttttaaatcataatttaaaattaattaaaaaaacaaatccaaaaaatgcaatt
aaacatccaacatggaaaatgggtaaaaaaatttctatagactctgctacattaatgaac
aaagtttttgaattaatagaagccataaaaatatttgatataaaaaaatcaaattttaag
attattattgaaccttcatcatatgtacatgcaattgtagaatttaagaatggtgtaaca
aaatttttaactcatcctacttcaatgcaaataccaatatataattctttatataatgtt
aatcataatttcaaatttgaaaaaattaatcttaataaattgaataaattaaactttcaa
aatattgattttaaaagatttcctatcaacaaaatattaaatcaaataatagataacgat
tctctttttgatacagttctaataacagctaatgacacattagtagatttatttctaaag
aaaaaaatttctttttatgaaatttatgaaaaattaaataccattcttaatttaaaagaa
tttaatatacttaaatcaattaggccaaaaaatataagtcaaataacagatattagtcat
aaagtaagattgaaaacacaatctttaagtgtaagatccagaatttaa

DBGET integrated database retrieval system