KEGG   Alpha proteobacterium HIMB5: HIMB5_00005790Help
Entry
HIMB5_00005790    CDS       T02250                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01130  Biosynthesis of antibiotics
apm01230  Biosynthesis of amino acids
Module
apm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB5_00005790
Enzymes [BR:apm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HIMB5_00005790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C MIT
Motif
Other DBs
NCBI-ProteinID: AFS47344
UniProt: J9YTT3
Position
complement(528918..529709)
Genome map
AA seq 263 aa AA seqDB search
MSENILEKIISKKIKRVDEIKKTTKIEDLTKIIEQNKSYIDFKEKIKSNIQENKTSLIAE
IKKASPSAGVIIDDYNPVDIAKIYYEKKATCLSVLTEEEFFLGNLIHISKIKDNFNLPIL
CKDFFIDKFQIPLAKSYGSDAILIILAGVSDDLAYDLYEEALRYNMSVIVEVHTVEEAKK
ALHFKEALIGINNRNLKTLKTDINTTYAIHDVLKDHKEPLISESGIKTKDEVLDLEDKTK
IKTFLIGESLLKDLEKNSIFSIL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaacatactggaaaaaattatctctaaaaaaattaagagggttgatgaaata
aagaaaactacaaaaattgaagaccttacaaaaattattgaacaaaataaaagctatatt
gattttaaagaaaaaataaaatcaaatatccaagaaaataaaacatcacttattgctgaa
attaaaaaagcaagcccatcagctggtgtaattattgatgattataatcctgttgatatt
gctaaaatctattatgaaaagaaagcaacttgtttatctgttttaactgaggaagaattt
tttttaggaaatttaattcatatcagtaaaattaaagataactttaatttaccaattctt
tgtaaagattttttcatcgataaatttcaaataccacttgcaaaaagctatggttctgat
gctattttaatcatacttgctggtgttagtgatgatttagcttatgacttatatgaagaa
gctttaagatataacatgtctgtgattgttgaggttcatacagttgaagaagcaaaaaaa
gcattacattttaaagaagctttaattggaattaataatagaaacttaaaaactttaaaa
acagacataaatacaacctatgctattcatgatgtgcttaaagatcataaagaacctttg
atctcagagagcggaattaaaacaaaagatgaagttttagatcttgaagataaaacaaag
attaaaacttttttaattggtgaatcacttttgaaagatttggaaaaaaattctattttt
tcaattttgtag

DBGET integrated database retrieval system