KEGG   Alpha proteobacterium HIMB5: HIMB5_00005840Help
Entry
HIMB5_00005840    CDS       T02250                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00005840
   01230 Biosynthesis of amino acids
    HIMB5_00005840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00005840
   00051 Fructose and mannose metabolism
    HIMB5_00005840
   00562 Inositol phosphate metabolism
    HIMB5_00005840
Enzymes [BR:apm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HIMB5_00005840
Exosome [BR:apm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HIMB5_00005840
  Exosomal proteins of bladder cancer cells
   HIMB5_00005840
  Exosomal proteins of melanoma cells
   HIMB5_00005840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534198..534935
Genome map
AA seq 245 aa AA seqDB search
MTNKYMYFVANWKMFGDFKSLKLVNKVISFSKKFKSSKFKIIYLPPTTLICPMAQMVKNT
KIEVGAQNCHHQDNFGAETGSVNAKMVKGVGAKYVILGHSENRENGESDKLINQKIKTAL
KNKLKVIFCIGEKIKDKRNKKTKSVLSKQIKLGLKGIKLNNNIIIAYEPVWAIGSGMIPK
SNDLLNAIDFIKSRFKQNLKILYGGSVNDKNINELKTIHNIDGFLVGGASQNSKKFIDII
KKTYN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaatatatgtattttgtagctaattggaaaatgtttggtgattttaaatct
ctaaaactagtaaacaaagttattagttttagtaaaaaatttaaatcctcaaaatttaag
ataatttatctaccacctacaactctaatctgcccaatggcccaaatggtaaaaaataca
aaaattgaagtaggtgcgcaaaactgtcatcatcaagataattttggagctgagacaggt
tcagtaaacgccaagatggtaaaaggtgtaggtgcaaagtatgtaattttaggtcactcc
gagaaccgtgaaaatggagaaagtgacaagcttattaatcaaaaaattaaaacagcatta
aaaaacaaattaaaagtaattttttgtattggagaaaaaattaaagataaaagaaataaa
aaaactaaatcagttttatctaaacaaattaaacttggtcttaagggaattaaattaaat
aataatattataattgcttacgaaccagtatgggcaattggaagtggcatgatacctaaa
tcaaatgatttattaaatgcaatagatttcattaaaagtagatttaaacaaaatctaaaa
attctatatggtggatctgtaaatgataaaaatattaatgaattaaaaactattcataat
attgatggttttttagtgggcggtgcttctcaaaattcaaaaaaatttattgatataata
aaaaaaacatataattaa

DBGET integrated database retrieval system