KEGG   Alpha proteobacterium HIMB5: HIMB5_00005840Help
Entry
HIMB5_00005840    CDS       T02250                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:apm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:apm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:apm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:apm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534198..534935
Genome map
AA seq 245 aa AA seqDB search
MTNKYMYFVANWKMFGDFKSLKLVNKVISFSKKFKSSKFKIIYLPPTTLICPMAQMVKNT
KIEVGAQNCHHQDNFGAETGSVNAKMVKGVGAKYVILGHSENRENGESDKLINQKIKTAL
KNKLKVIFCIGEKIKDKRNKKTKSVLSKQIKLGLKGIKLNNNIIIAYEPVWAIGSGMIPK
SNDLLNAIDFIKSRFKQNLKILYGGSVNDKNINELKTIHNIDGFLVGGASQNSKKFIDII
KKTYN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaatatatgtattttgtagctaattggaaaatgtttggtgattttaaatct
ctaaaactagtaaacaaagttattagttttagtaaaaaatttaaatcctcaaaatttaag
ataatttatctaccacctacaactctaatctgcccaatggcccaaatggtaaaaaataca
aaaattgaagtaggtgcgcaaaactgtcatcatcaagataattttggagctgagacaggt
tcagtaaacgccaagatggtaaaaggtgtaggtgcaaagtatgtaattttaggtcactcc
gagaaccgtgaaaatggagaaagtgacaagcttattaatcaaaaaattaaaacagcatta
aaaaacaaattaaaagtaattttttgtattggagaaaaaattaaagataaaagaaataaa
aaaactaaatcagttttatctaaacaaattaaacttggtcttaagggaattaaattaaat
aataatattataattgcttacgaaccagtatgggcaattggaagtggcatgatacctaaa
tcaaatgatttattaaatgcaatagatttcattaaaagtagatttaaacaaaatctaaaa
attctatatggtggatctgtaaatgataaaaatattaatgaattaaaaactattcataat
attgatggttttttagtgggcggtgcttctcaaaattcaaaaaaatttattgatataata
aaaaaaacatataattaa

DBGET integrated database retrieval system