KEGG   Alpha proteobacterium HIMB5: HIMB5_00005840Help
Entry
HIMB5_00005840    CDS       T02250                                 

Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00005840
   01230 Biosynthesis of amino acids
    HIMB5_00005840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00005840
   00051 Fructose and mannose metabolism
    HIMB5_00005840
   00562 Inositol phosphate metabolism
    HIMB5_00005840
Enzymes [BR:apm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HIMB5_00005840
Exosome [BR:apm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HIMB5_00005840
  Exosomal proteins of bladder cancer cells
   HIMB5_00005840
  Exosomal proteins of melanoma cells
   HIMB5_00005840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534198..534935
Genome map
AA seq 245 aa AA seqDB search
MTNKYMYFVANWKMFGDFKSLKLVNKVISFSKKFKSSKFKIIYLPPTTLICPMAQMVKNT
KIEVGAQNCHHQDNFGAETGSVNAKMVKGVGAKYVILGHSENRENGESDKLINQKIKTAL
KNKLKVIFCIGEKIKDKRNKKTKSVLSKQIKLGLKGIKLNNNIIIAYEPVWAIGSGMIPK
SNDLLNAIDFIKSRFKQNLKILYGGSVNDKNINELKTIHNIDGFLVGGASQNSKKFIDII
KKTYN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaatatatgtattttgtagctaattggaaaatgtttggtgattttaaatct
ctaaaactagtaaacaaagttattagttttagtaaaaaatttaaatcctcaaaatttaag
ataatttatctaccacctacaactctaatctgcccaatggcccaaatggtaaaaaataca
aaaattgaagtaggtgcgcaaaactgtcatcatcaagataattttggagctgagacaggt
tcagtaaacgccaagatggtaaaaggtgtaggtgcaaagtatgtaattttaggtcactcc
gagaaccgtgaaaatggagaaagtgacaagcttattaatcaaaaaattaaaacagcatta
aaaaacaaattaaaagtaattttttgtattggagaaaaaattaaagataaaagaaataaa
aaaactaaatcagttttatctaaacaaattaaacttggtcttaagggaattaaattaaat
aataatattataattgcttacgaaccagtatgggcaattggaagtggcatgatacctaaa
tcaaatgatttattaaatgcaatagatttcattaaaagtagatttaaacaaaatctaaaa
attctatatggtggatctgtaaatgataaaaatattaatgaattaaaaactattcataat
attgatggttttttagtgggcggtgcttctcaaaattcaaaaaaatttattgatataata
aaaaaaacatataattaa

DBGET integrated database retrieval system