KEGG   Alpha proteobacterium HIMB5: HIMB5_00006290Help
Entry
HIMB5_00006290    CDS       T02250                                 

Definition
glycosyl hydroalse family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HIMB5_00006290
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    HIMB5_00006290
Enzymes [BR:apm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HIMB5_00006290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575919..576869
Genome map
AA seq 316 aa AA seqDB search
MIKSRRAFITGIKSLKLNSSEIKFLKKYKPWGVILFSRNIKDITQTKKLTDHIKKIFRDK
NYPILIDQEGGRVNRLNNIISFNTLTSEYFGDLYKKNKFKFNIIYKMFVDQTSHLLKLIG
ANINTLPVLDIRIKGSSNIIGDRSFSKDPKIVSKIGDLCIKYFHDNSIGTVIKHIPGHGE
AKVDSHLFTPTVKKKLSKLLTSDFSPFKNKKSFFAMTAHVIYDDIDKFNTATHSEKVIKL
IRNKIGFKKILISDDLSMKSLKKDLKFNTIRTFSSGCNIALHCNGKLNEMTTVASNSPLV
DSFIVQKTSEFYKILR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagtaggagagcttttataacaggtataaaatccttaaaactcaattcatct
gaaattaaattcttaaaaaaatataaaccttggggtgtcattcttttttcaaggaacata
aaagatattacgcaaacaaaaaaactaactgaccatataaaaaagatttttagagataaa
aattatccaatcttaattgatcaagaagggggcagagtaaatagattaaataatattata
tcatttaatacattaacttctgaatattttggagatctgtataaaaagaataagtttaaa
tttaatattatttataaaatgtttgttgatcaaacatctcatttattaaaattaattgga
gctaatattaacacattaccagttttagatataagaattaaaggttctagtaatataatt
ggagatagatccttttcaaaagaccctaagattgtttcaaaaataggcgatctttgcatt
aaatattttcatgataattcaataggaaccgtaataaaacatataccaggtcatggtgaa
gctaaagttgacagtcatctctttacaccaactgttaagaaaaaattatcaaaattacta
actagtgatttttctccatttaaaaataagaaaagtttttttgcgatgactgcacatgta
atttacgatgatattgataaatttaatacagcaacgcactcagaaaaagttatcaaacta
atcagaaataaaattggctttaaaaaaattttgatttccgatgacttatcaatgaaaagt
ttaaaaaaagatttaaaatttaatacaatcagaacattcagctcaggttgtaatattgct
cttcattgcaatgggaaattaaatgaaatgacaacagttgcgtcaaactcaccactagta
gatagttttattgttcaaaaaacttcagaattttataagattttaagataa

DBGET integrated database retrieval system