KEGG   Alpha proteobacterium HIMB5: HIMB5_00006290Help
Entry
HIMB5_00006290    CDS       T02250                                 

Definition
glycosyl hydroalse family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:apm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:apm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575919..576869
Genome map
AA seq 316 aa AA seqDB search
MIKSRRAFITGIKSLKLNSSEIKFLKKYKPWGVILFSRNIKDITQTKKLTDHIKKIFRDK
NYPILIDQEGGRVNRLNNIISFNTLTSEYFGDLYKKNKFKFNIIYKMFVDQTSHLLKLIG
ANINTLPVLDIRIKGSSNIIGDRSFSKDPKIVSKIGDLCIKYFHDNSIGTVIKHIPGHGE
AKVDSHLFTPTVKKKLSKLLTSDFSPFKNKKSFFAMTAHVIYDDIDKFNTATHSEKVIKL
IRNKIGFKKILISDDLSMKSLKKDLKFNTIRTFSSGCNIALHCNGKLNEMTTVASNSPLV
DSFIVQKTSEFYKILR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagtaggagagcttttataacaggtataaaatccttaaaactcaattcatct
gaaattaaattcttaaaaaaatataaaccttggggtgtcattcttttttcaaggaacata
aaagatattacgcaaacaaaaaaactaactgaccatataaaaaagatttttagagataaa
aattatccaatcttaattgatcaagaagggggcagagtaaatagattaaataatattata
tcatttaatacattaacttctgaatattttggagatctgtataaaaagaataagtttaaa
tttaatattatttataaaatgtttgttgatcaaacatctcatttattaaaattaattgga
gctaatattaacacattaccagttttagatataagaattaaaggttctagtaatataatt
ggagatagatccttttcaaaagaccctaagattgtttcaaaaataggcgatctttgcatt
aaatattttcatgataattcaataggaaccgtaataaaacatataccaggtcatggtgaa
gctaaagttgacagtcatctctttacaccaactgttaagaaaaaattatcaaaattacta
actagtgatttttctccatttaaaaataagaaaagtttttttgcgatgactgcacatgta
atttacgatgatattgataaatttaatacagcaacgcactcagaaaaagttatcaaacta
atcagaaataaaattggctttaaaaaaattttgatttccgatgacttatcaatgaaaagt
ttaaaaaaagatttaaaatttaatacaatcagaacattcagctcaggttgtaatattgct
cttcattgcaatgggaaattaaatgaaatgacaacagttgcgtcaaactcaccactagta
gatagttttattgttcaaaaaacttcagaattttataagattttaagataa

DBGET integrated database retrieval system