KEGG   Alpha proteobacterium HIMB5: HIMB5_00006620Help
Entry
HIMB5_00006620    CDS       T02250                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00480  Glutathione metabolism
apm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HIMB5_00006620
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HIMB5_00006620
Enzymes [BR:apm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HIMB5_00006620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFS47422
UniProt: J9YWI9
Position
complement(604993..605544)
Genome map
AA seq 183 aa AA seqDB search
MKLLKLTLFITILMFTFLSKSNAKYEKIFYDFEIKSITGENIKLSDYKGKTVLLVNVASN
CGFTKQYSDLQNLYEKYKDQNFIVLGVPSNQFGGQEPGSNKEIKEFCETNFNITFPMTEK
VNVKGDDAHPIYKWAKENFGNSSVPKWNFHKIIINNEGKIQEAYGSFTKPLSSKIISVLE
KIL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattgaaattaactttatttataacaatattaatgtttacttttctatcaaaa
tcaaacgcaaaatatgaaaaaattttttatgattttgaaattaaatctatcacaggtgag
aacattaaattatcagattataaaggcaaaactgtattgctagtaaacgttgcaagtaac
tgtggttttacaaaacaatattcagatttacaaaatttatatgaaaaatataaggatcaa
aattttatagttttaggtgttccctcaaatcaatttggcggtcaagaacctggatcaaat
aaagaaataaaagagttttgtgaaacaaatttcaatattacttttcctatgacagaaaaa
gtaaatgttaagggtgatgatgcgcatcccatttataaatgggcaaaagaaaattttggc
aattcatctgttccaaaatggaatttccataaaatcataataaataatgaaggtaaaatt
caagaagcatatggttcatttacaaaaccattatcatcaaaaattatttctgttttagaa
aagattttataa

DBGET integrated database retrieval system