KEGG   Alpha proteobacterium HIMB5: HIMB5_00007170Help
Entry
HIMB5_00007170    CDS       T02250                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HIMB5_00007170
Enzymes [BR:apm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HIMB5_00007170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646174..646686)
Genome map
AA seq 170 aa AA seqDB search
MTKQDISENQVKTVFLGIGSNLGNRKRNIELSKFKLHLENIEIIKCSSNYETPSWPNPKK
PKFINIVLKIKTYLLPQKLLELCKKIERELGRKKRKKNDPRECDIDIIDYSGLILNKEIV
LPHTLMHQRNFVLIPLYEIQKDWKHPKLKRNIKDLISQLPNKDIRSIKQI
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagcaagatatatcagaaaatcaagttaagactgtttttttagggattggttca
aacttaggtaacagaaaaagaaatatagaattatcaaaatttaaacttcatttagaaaat
atagaaataattaaatgctcaagtaattatgagacaccatcttggccaaatcctaaaaaa
ccaaaatttattaatatagttttaaagataaaaacatatttattacctcaaaaattatta
gaattatgtaagaaaatagagagagaattagggagaaaaaaaagaaaaaaaaatgaccca
agagaatgtgatatagatattattgattatagtggtttaattctcaataaagaaattgtt
ctccctcatacattgatgcatcaaagaaattttgttttaattcctttgtatgaaatccaa
aaagattggaaacaccctaaattaaagagaaatattaaagatttgatcagtcaacttcca
aataaagacataagaagtattaaacaaatttaa

DBGET integrated database retrieval system