KEGG   Alpha proteobacterium HIMB5: HIMB5_00007420Help
Entry
HIMB5_00007420    CDS       T02250                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HIMB5_00007420
   00052 Galactose metabolism
    HIMB5_00007420
   00500 Starch and sucrose metabolism
    HIMB5_00007420
   00520 Amino sugar and nucleotide sugar metabolism
    HIMB5_00007420
Enzymes [BR:apm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HIMB5_00007420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(671530..672345)
Genome map
AA seq 271 aa AA seqDB search
MIKQAIIPLAGLGTRLLPLTSVFAKELLPINGKPGLEYILDECFEAGIKEIIFIISDKKK
MIKDYFYNDTFYKKILKKKKDIRILKEYKKILKYKKMIKFVYQNKPLGTGDAVMKTKKHI
KSNHFLMLLPDDLIIKNNCSKEMINVHKKHKSSVMASMTVNKKTVSRWGIYKLSKKLSKN
NYKIEDVIEKPKIKDAPSNKAVIGRYILPKKIFSEIKDLKPGKGGEIHITDAIQNLIKKN
NLFVAHNFKGKYLDCGTLHGYINSTLEISKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaagcaattattccactagcaggattaggaaccagactccttccattaaca
agtgtttttgctaaagaacttttaccaattaatggaaagcctggacttgaatatatatta
gatgaatgttttgaggcaggtataaaagagataatttttattatctcagataaaaaaaag
atgattaaggattatttctacaatgataccttttataaaaaaattttgaaaaaaaagaaa
gatataaggatattgaaagaatataagaaaattttaaaatataagaaaatgataaagttt
gtttatcaaaacaaacctcttggaacaggtgatgctgttatgaaaacaaaaaaacatatc
aaatcaaatcattttttgatgctactacctgatgatctaattattaaaaataattgttca
aaagaaatgataaatgttcacaaaaaacataaatcttcagtcatggctagtatgactgta
aataaaaagactgtatcaagatggggtatttataaactatcaaaaaaactttctaaaaat
aattataaaattgaagatgtgattgaaaaacctaaaattaaagatgcaccttccaataaa
gcagtaataggcagatacattctcccaaaaaaaatttttagtgagattaaagatttaaaa
cctggcaagggaggagaaattcatatcactgatgcaattcaaaacttaataaaaaaaaat
aatctatttgttgctcacaattttaaaggaaagtatcttgattgtggtactttacatggt
tatatcaattcaactttagaaatatcaaaactatga

DBGET integrated database retrieval system