KEGG   Alpha proteobacterium HIMB5: HIMB5_00009360Help
Entry
HIMB5_00009360    CDS       T02250                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HIMB5_00009360
Enzymes [BR:apm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HIMB5_00009360
Exosome [BR:apm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIMB5_00009360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(856430..857911)
Genome map
AA seq 493 aa AA seqDB search
MQKFIISIDQGTTSSRAILFDLRGKPKFVSQMEFTQYFPKDGWVEHNPEEIWSTTQKVLR
DVIKKSKQLKGKILTIGITNQRETTILWDKHTGKPVYNAIVWQDRRAVDYCNKLIKQKKE
TIVYNKTGLLIDAYFSATKIKWIIDNVPKAKELIKQKRLLFGTVDCFLLWRLTGGTNHFT
DASNASRTMLFNITNNKWDKQILDMLKIPEHILPEVKDCSDDFGHTDPKITGESYSITGM
IGDQQSATVGQCCFEPGSLKSTYGTGAFLLLNTGNKIIYSKNKLLTTIGYRLNGKTTYAL
EGSIFIAGAGVQWLRDKINFIKKASDTEKLIKKLNSNSGIYLVPAFTGLGTPYWNAKSRG
VLSGLTRDTGVNEIVRATVESVAYQTYDLFEAMKNDGLRPKLVRVDGGMVKNNWFSQFLS
DVVNVKVLRPKVDETTALGAAFMAGLKIGVYKSLKDISKNWSLDKKFSPKMKNSKRKTLI
TGWEKAIKRSLIT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttataatctctatagatcaaggaacaacttcgagtagggcaattttattt
gatttaagaggtaagccaaaatttgtatcacaaatggaatttactcaatactttccaaaa
gatggatgggttgaacataacccagaggaaatttggtcaactactcaaaaagttttgaga
gatgtaataaaaaaaagcaaacaattaaaaggtaaaattttaacaataggaattaccaat
caaagagaaactacaattctttgggataaacacactggtaaaccagtatacaatgcaatt
gtttggcaagatagaagagcagtcgattattgtaataaacttattaagcaaaaaaaagaa
acaattgtttacaataaaacaggattacttattgatgcctatttttcagcaacaaaaatt
aaatggataattgataatgttcctaaggcaaaagaactaattaaacaaaaaagattatta
tttggaacagtagattgttttttattgtggagattaacaggaggcactaatcattttaca
gacgcctctaatgctagcagaacaatgttgtttaatataactaacaataagtgggataaa
caaattttagatatgcttaaaatacctgagcacatattgcccgaagtaaaagattgctct
gatgattttggacatacagatcccaagataacaggcgagtcttattcaattacagggatg
ataggagatcaacaatcagcaactgtaggccaatgttgttttgaacctggttctttaaaa
agtacatacggtactggtgcatttttactattaaatactggtaataaaataatttattca
aaaaataaattattaactactattggatatagattgaacggaaaaacaacttatgcactc
gagggttcaatatttattgcaggtgctggagtacaatggctaagagataaaatcaatttt
ataaaaaaagcatctgacactgaaaaattaattaaaaaactaaactctaatagtggaatt
tatttagttcctgcgtttactggattagggacgccgtattggaatgcaaaatctagaggt
gtattaagtggtttgactagagacacaggtgtaaatgaaattgtaagagcaacagtagag
tctgttgcttatcaaacttacgatttatttgaagcaatgaaaaatgatggtcttagacca
aaactagtaagagttgatggtggtatggtaaagaataattggttttctcaatttttgagt
gatgtagttaatgttaaagttttaaggccaaaagttgatgaaacaactgcattaggtgct
gcatttatggctggtttaaaaattggtgtttacaaatctttaaaagatatttctaaaaat
tggtctttagacaaaaagttttctcccaaaatgaaaaattcaaaaagaaaaacacttatc
actggttgggaaaaagctatcaaaagaagtttaataacataa

DBGET integrated database retrieval system