KEGG   Alpha proteobacterium HIMB5: HIMB5_00009690Help
Entry
HIMB5_00009690    CDS       T02250                                 

Definition
agmatinase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891418..892377)
Genome map
AA seq 319 aa AA seqDB search
MKKEKNKNPIQPVSGTKVPRYAGPSTFARLPELRDVESCDVAIVGVPFDAGTSYRPGARF
GPQSIRQASRHLRTNYHPSYDVEPFKIQQVADAGDIACNPFSIDEAIKQIEVGATDLLNK
VGGIISLGGDHTIAVPLLRAINKKMNGPVSLVHFDAHLDTWDTYFGAPYTHGTPFRRARE
EGLFLDDASMHVGIRGPLYSRDDIKNDESFGFKIIHCDEFQTEGTDKIAERIRKRVGDNP
LYLSIDIDVLDPAFAPGTGTPEIAGMTTREMVNVLRGLSGLNLVSADVVEVSPAYDHAEV
TSLAAATIVYELTNLFAKT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaaaaaataaaaatcctattcaaccagttagtggaactaaagttccaaga
tatgctggaccatcaacatttgcaagattaccagagttaagagatgttgaaagttgtgat
gttgcaattgttggtgttccttttgatgctggaacaagctacagaccaggtgctagattt
ggaccacaaagtattcgtcaggcttcaagacatttaagaaccaattatcatccaagttat
gatgttgaaccatttaaaattcaacaagtagccgatgctggagatattgcctgcaatcca
ttcagtattgatgaagctattaaacaaatagaagtgggagctacagatttattaaataaa
gttgggggaattattagtttaggtggtgatcatacgatcgcagttccattattaagagca
ataaataagaaaatgaatggaccagtatctttagttcattttgatgctcatttagatact
tgggatacttactttggagcgccttacactcatggaactccgtttagaagagcaagagaa
gaaggtttatttttagatgatgcctcaatgcatgttggaataagaggtcctctttatagt
agggatgacattaaaaatgatgagagttttggatttaaaattattcactgtgatgaattt
caaacagaaggcacagataaaattgctgaaagaattagaaaaagagtaggcgataatcct
ctttatttatcaattgatattgatgttttagatccagcttttgcaccaggaactggtact
cctgagattgcaggaatgacaaccagagaaatggtaaatgttctaagaggtttatctgga
ttaaatttagtttcagctgatgttgtagaagtttcgccagcttatgaccatgcagaagtt
acttctcttgcagctgcaacaatagtttatgaattaacaaatttatttgcaaaaacataa

DBGET integrated database retrieval system