KEGG   Alpha proteobacterium HIMB5: HIMB5_00011510Help
Entry
HIMB5_00011510    CDS       T02250                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00011510
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HIMB5_00011510
   00630 Glyoxylate and dicarboxylate metabolism
    HIMB5_00011510
Enzymes [BR:apm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HIMB5_00011510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064799..1066961
Genome map
AA seq 720 aa AA seqDB search
MTNTYKNIGNLKVSEILADFVNKELLEGTNLKPEKFWEGFEKVIHELAPKNKELINIRED
IQNKINDWHKANKGNEIHLENYKKFLKDIGYLKEEGPDFKIETKNVDKEITSVAGPQLVV
PIMNARYALNAANARWMSLYDSLYGTDVIEESEDSTSQRYDPERGELVIKYGREFLDKYF
PLNDFSWKKITGTAIQDGELKVLKGIDVTTLKETNKFIGHRGEADNPSAIILKNNNLHIE
ILKNPRAFSAQQDHAGISDIILESAISTICDNEDSVAAVDAEDKILCYRNWLGLMKGDLV
SRFEKEGKTLERKLNPNRSYISKDGKGLKLHGRSLLLVRNVGHLMTNPSILLKDGNEIPE
GLMDAFITTAAALHDFKRKGNSRTGSIYIVKPKMHGPDETAFTDEIFTKVEEVLGLEKYT
CKIGIMDEERRTSSNLKECIRSLKNRVFFINTGFLDRTGDEMHTSMEAGPMIKKGDMKSS
KWIQAYENNNVDIGLSCGFSGKAQIGKGMWAMPDKMKDMLEQKTGHLKAGANCAWVPSPT
AAAIHALHYHEIDIFNVQKELTKRQKAKLDDLLTIPVADRPNWSVDEINQEISNSAQTLL
GYVVRWVDQGVGCSKVPDINNIGLMEDRATLRISSQHIANWIHHGITTKIQVTEIMKEMA
KVVDEQNKNDPKYIKMSENFDNSIAFKTACDLIFKGTKQPSGYTEPLLHQNRLEIKSNLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgactaatacatacaaaaatatcggaaatttaaaagtctcggaaattttagctgatttt
gtaaataaagaactattagaaggaacaaatcttaagcctgaaaaattttgggaaggtttt
gaaaaagtcatacatgagttggcgcccaagaataaagaacttattaacataagagaagat
attcaaaataaaattaacgactggcataaagcaaataagggaaatgaaatacatttagaa
aattataaaaagtttcttaaagatatagggtacttaaaagaagaagggcctgattttaaa
attgaaaccaaaaatgttgataaagaaatcacatctgtagctgggcctcaacttgttgtt
ccaataatgaacgcaagatatgctctaaatgctgctaacgctcgatggatgagtttatat
gattctttgtatggaactgatgtaattgaagaatctgaagatagtacatcacaaagatat
gaccctgaaagaggagaacttgtaattaaatatggaagagaatttttagataaatatttt
cctttaaacgattttagttggaaaaaaattactggtacggcaattcaagatggtgaattg
aaagttctaaaaggtattgatgttacaacattgaaagaaacaaataagtttataggtcac
cgtggagaagcagacaacccttctgcaataattctaaaaaataataaccttcatattgag
atattaaaaaatccaagagcatttagtgcgcaacaggatcatgctggtataagtgatatt
attttagaatcagctatttctactatctgtgataacgaagatagtgttgctgcagttgat
gctgaagataaaatcctttgttatagaaattggttgggtttaatgaagggtgatctagtt
agtcggtttgagaaagaaggtaaaacattagagagaaaattaaacccaaacagaagttat
atttcaaaagatggtaaaggattaaaacttcatggaagaagtttgttgctagtaagaaat
gttggacatttaatgactaatccatcaattttattaaaagatggaaatgaaattccagaa
ggcttaatggatgcattcattactacagctgcagcccttcatgattttaaaagaaaaggt
aattctagaactggttcaatttatattgttaaaccaaaaatgcatggaccagatgaaact
gcatttacagatgaaattttcacaaaagttgaagaagtgttaggtctagaaaagtatact
tgtaaaattggaattatggatgaagaaagaaggacatcatcaaaccttaaagagtgtatc
agatctttaaaaaatagagtcttctttattaatactggtttcttagaccgtacaggtgat
gagatgcatacatctatggaagctggtccaatgattaaaaaaggagatatgaaatcttct
aagtggatacaagcctatgaaaataataacgttgatattggattgtcgtgtggattttct
ggtaaagcacaaataggaaaaggtatgtgggcaatgccagataagatgaaagatatgcta
gaacaaaaaactggtcatcttaaagcaggagcaaattgtgcatgggttccttcgcctacg
gctgcagcaattcatgctcttcattatcatgagattgatatatttaatgttcaaaaagaa
ttaacaaaaagacaaaaagctaaacttgatgatttattgacaattccagttgctgataga
ccgaactggtctgtagatgaaataaatcaggaaatttccaattctgctcaaacactgtta
ggttatgtagtaagatgggtcgatcaaggtgttggatgttcaaaagttcctgacataaat
aatattggtttaatggaagatagagcaacattaagaatttcttcacaacacattgcaaac
tggatacatcacggaataaccacaaaaattcaagttacagaaataatgaaagaaatggca
aaagtagttgatgaacaaaacaaaaacgatcctaagtatattaaaatgagtgaaaatttt
gacaattctattgcctttaaaactgcttgtgatttaatttttaagggcactaaacaacct
tcaggttatacagaacctttattgcatcaaaatagattggaaattaaatctaatctgaac
tag

DBGET integrated database retrieval system