KEGG   Alpha proteobacterium HIMB5: HIMB5_00011520Help
Entry
HIMB5_00011520    CDS       T02250                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIMB5_00011520
DNA repair and recombination proteins [BR:apm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HIMB5_00011520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1066948..1067559)
Genome map
AA seq 203 aa AA seqDB search
MQNINEIEELIKVISKLPGLGPKSAKRIVLKLINNKDELVKPMANTLAQVYKNVTRCQSC
GSLKSNITGCLNCENLKEKFNKICVVEDIADKWSIENSNIFKGYFHILGGTISSAGVNKE
DLLINSLVERVKKEKIEEVIIATSATVEGQTTAYYIQDSLKNTSAKITKLAQGLPVGGEI
ESLDDGTLYSAFKYRSDLKTSSD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatattaatgagatagaagagttaattaaagtaatttcaaaattacccggatta
ggtccaaaatctgcaaaaagaattgttttaaaactaataaataataaagatgaactggta
aagcctatggcaaatactcttgctcaggtttataaaaatgtaactagatgtcagtcatgt
gggtctttaaaatcaaatattacaggttgtttaaattgtgaaaatcttaaagagaaattt
aataaaatttgtgtagtagaagatatcgctgataaatggtcaattgaaaattcaaatatt
tttaaaggttattttcatattcttggaggaacgatctcttcagcaggtgtaaacaaagaa
gatttattaataaactcattagttgaaagagtaaaaaaagaaaaaattgaagaggtaatt
attgcaactagtgcaactgttgaaggtcaaacaacagcatattacattcaagacagtttg
aaaaatacttcagcaaaaataacaaaattggcacagggattaccagttggtggtgagata
gaaagtttagatgatggaactttgtattctgcttttaaatacagatcagatttaaaaact
agttcagattag

DBGET integrated database retrieval system