KEGG   Alpha proteobacterium HIMB5: HIMB5_00011570Help
Entry
HIMB5_00011570    CDS       T02250                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:apm00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:apm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071342..1071881
Genome map
AA seq 179 aa AA seqDB search
MDSFEINKIIAAVLLVALLVIGIGKVSNILFYVEKPKTPGYAVEVEQASGTSITTAEVVE
KVVDIAALMALGDVASGEKIFKKCAACHSINKGGKHKIGPALYNVVGRKVGVVEDYKYSK
ALIAYEKEWTFEELNGFLIKPAKHIKGTKMAYAGLRKEADRASVIKYLNANSDSPLPLP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggattcattcgaaataaataaaattattgctgctgttttattagttgctcttttagta
attgggattggtaaggtttctaatatattattctatgtggaaaaaccaaaaacaccaggt
tatgcagttgaagttgaacaagcatctggtacctcaattacaacagctgaagttgttgaa
aaagttgtagatattgctgctctgatggcattaggagatgtagcaagtggtgaaaaaatt
tttaaaaagtgtgcagcttgccattcaattaataaagggggcaaacataaaattggccca
gctctatataatgttgttggaagaaaagttggagtagttgaggactacaaatattctaaa
gcacttatagcttacgaaaaagaatggacatttgaagaattaaatggatttttgataaaa
cctgcaaaacatattaaaggaactaaaatggcttatgcgggtcttagaaaagaggcagac
agagcatctgttataaaatatttaaatgctaactctgatagtccgttaccactaccttaa

DBGET integrated database retrieval system