KEGG   Alpha proteobacterium HIMB5: HIMB5_00011720Help
Entry
HIMB5_00011720    CDS       T02250                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00260  Glycine, serine and threonine metabolism
apm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01130  Biosynthesis of antibiotics
apm01230  Biosynthesis of amino acids
Module
apm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00011720
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB5_00011720
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIMB5_00011720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP BORCS6 Adenine_deam_C TPP_enzyme_C DUF2058
Motif
Other DBs
NCBI-ProteinID: AFS47916
UniProt: J9YY82
Position
1083818..1085008
Genome map
AA seq 396 aa AA seqDB search
MTKNSLKKGPDEFGYYGEGESAMGGIAVGETLMPALHELSQGFEEAIKDKNFLDEYAYYC
KHYIGRPSPLYYAENLTKKLGGAKILFKQEHLNHTGSHKINNSLFQVLLAKRMGKKYLLC
ESGAGQHYSATAAVAAKFSLPLVGIMGDVDVQRVNQNIIKAKHYGAKLKAVPGTLKEAIT
EAIKTWTTDPDSAYICGSVVSAHPFPKIVAFAQSIIGREIREQSLEQEGKIPDMIIGCVG
GGSNFAGAIYEFLDEKNVEKIGVEAAETAALSNGTPGIMQGMKTYLLQSEDGAKSLGGNS
LGAGIQYFGVGPLHSYLHDQKAVTYTSATDEEILNAYKMIAKYEGISSALEPMAAAAHLI
KIAKDKPKDFLICLSLCGRGEKDLDTLEQHIGKDFE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaactcattaaaaaaaggtcctgatgaattcggttattacggcgaaggtgag
agtgcaatgggaggaattgctgttggtgaaacattaatgcctgcacttcatgaattaagc
caaggttttgaggaagcaattaaagataaaaactttttagatgaatatgcttattattgt
aaacattatataggaagaccttctccactatattatgctgaaaacttaaccaaaaaactt
ggtggagcaaaaattttatttaaacaagaacatttaaatcatacaggaagtcataaaatt
aataattcactattccaagtattattggcaaaaagaatgggtaagaaatatttattatgt
gaaagtggagctggacaacactactctgctactgctgctgtagcagctaaatttagttta
cctttggtgggtataatgggtgatgttgatgtgcaaagagtaaaccaaaatattattaaa
gctaaacactatggagcaaaattaaaagcagttcctggcacattaaaagaagctatcact
gaggctataaaaacttggacaactgatcctgatagcgcttacatttgtggatcagttgtg
tcagctcatccatttcctaaaattgtagcttttgctcaaagtataattggaagagaaata
agagaacaatcattagaacaagaagggaaaattccagacatgataattggatgtgtgggt
ggtggttcaaactttgctggagcaatttatgaatttttagatgaaaagaatgtagaaaaa
ataggcgtcgaagcagctgaaactgcagcactatcaaatggtactcctggtataatgcag
gggatgaaaacatatctcttacaatctgaagatggagcaaagtcgcttggaggaaatagt
ttaggtgcaggaatacagtattttggcgttgggcctcttcatagttatttgcatgatcaa
aaagctgtaacttatacttcagcaacagatgaggaaattttaaatgcttataaaatgatt
gcaaaatatgaaggaatatcctccgctcttgagcctatggcagcagcagctcatttaatt
aaaattgctaaagataaaccaaaagattttttaatttgtctttcattatgtggtagagga
gaaaaagatctagatactctagaacaacatattggtaaagactttgagtaa

DBGET integrated database retrieval system