KEGG   Alpha proteobacterium HIMB5: HIMB5_00011720Help
Entry
HIMB5_00011720    CDS       T02250                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB5_00011720
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00011720
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB5_00011720
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIMB5_00011720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1083818..1085008
Genome map
AA seq 396 aa AA seqDB search
MTKNSLKKGPDEFGYYGEGESAMGGIAVGETLMPALHELSQGFEEAIKDKNFLDEYAYYC
KHYIGRPSPLYYAENLTKKLGGAKILFKQEHLNHTGSHKINNSLFQVLLAKRMGKKYLLC
ESGAGQHYSATAAVAAKFSLPLVGIMGDVDVQRVNQNIIKAKHYGAKLKAVPGTLKEAIT
EAIKTWTTDPDSAYICGSVVSAHPFPKIVAFAQSIIGREIREQSLEQEGKIPDMIIGCVG
GGSNFAGAIYEFLDEKNVEKIGVEAAETAALSNGTPGIMQGMKTYLLQSEDGAKSLGGNS
LGAGIQYFGVGPLHSYLHDQKAVTYTSATDEEILNAYKMIAKYEGISSALEPMAAAAHLI
KIAKDKPKDFLICLSLCGRGEKDLDTLEQHIGKDFE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaactcattaaaaaaaggtcctgatgaattcggttattacggcgaaggtgag
agtgcaatgggaggaattgctgttggtgaaacattaatgcctgcacttcatgaattaagc
caaggttttgaggaagcaattaaagataaaaactttttagatgaatatgcttattattgt
aaacattatataggaagaccttctccactatattatgctgaaaacttaaccaaaaaactt
ggtggagcaaaaattttatttaaacaagaacatttaaatcatacaggaagtcataaaatt
aataattcactattccaagtattattggcaaaaagaatgggtaagaaatatttattatgt
gaaagtggagctggacaacactactctgctactgctgctgtagcagctaaatttagttta
cctttggtgggtataatgggtgatgttgatgtgcaaagagtaaaccaaaatattattaaa
gctaaacactatggagcaaaattaaaagcagttcctggcacattaaaagaagctatcact
gaggctataaaaacttggacaactgatcctgatagcgcttacatttgtggatcagttgtg
tcagctcatccatttcctaaaattgtagcttttgctcaaagtataattggaagagaaata
agagaacaatcattagaacaagaagggaaaattccagacatgataattggatgtgtgggt
ggtggttcaaactttgctggagcaatttatgaatttttagatgaaaagaatgtagaaaaa
ataggcgtcgaagcagctgaaactgcagcactatcaaatggtactcctggtataatgcag
gggatgaaaacatatctcttacaatctgaagatggagcaaagtcgcttggaggaaatagt
ttaggtgcaggaatacagtattttggcgttgggcctcttcatagttatttgcatgatcaa
aaagctgtaacttatacttcagcaacagatgaggaaattttaaatgcttataaaatgatt
gcaaaatatgaaggaatatcctccgctcttgagcctatggcagcagcagctcatttaatt
aaaattgctaaagataaaccaaaagattttttaatttgtctttcattatgtggtagagga
gaaaaagatctagatactctagaacaacatattggtaaagactttgagtaa

DBGET integrated database retrieval system