KEGG   Alpha proteobacterium HIMB5: HIMB5_00011730Help
Entry
HIMB5_00011730    CDS       T02250                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00260  Glycine, serine and threonine metabolism
apm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01130  Biosynthesis of antibiotics
apm01230  Biosynthesis of amino acids
Module
apm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00011730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB5_00011730
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIMB5_00011730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE IGPS FMN_dh ALS_ss_C DHO_dh PcrB NMO PI-PLC-X ThiG Dus T2SSE
Motif
Other DBs
NCBI-ProteinID: AFS47917
UniProt: J9YXX4
Position
1085001..1085801
Genome map
AA seq 266 aa AA seqDB search
MSNRLKKIFQSLKPKTKLVSYFVGCYPNPEISFDLIKQAIDNGVSVLEIGYCTSEASAEG
PIIKKAHDDVLHNNYTLKDTIELVKKIRNYNSEVGIVLMGYIANLYKYPIPNFVTDIKNA
GADAVLVVDAPHELKEENILRECLNKNELSLIKLVAPTTDDQRLKDIIKVSSGFLYQVTV
TGTTGQKSADENTVKNFIDKIKNISNIPVCTGFGIKTPEDAKKMANTGPSGVIVGSAFVK
YIQDNLDDKELPQNLGKYIKSFVKEL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaacagactaaaaaaaatatttcaatctttgaagccaaaaacaaaattggtaagt
tattttgttggttgttatcctaacccagaaataagttttgatcttataaaacaagccata
gacaatggtgtttcagttcttgaaattggctactgcacatctgaagcatctgcagaaggg
ccaattataaaaaaggcacatgatgatgttttgcataataattacactttaaaagacaca
atagaattagttaaaaaaataagaaattataattctgaagttggtattgtattaatgggg
tatatagcaaatttatacaagtaccctattccaaactttgtaactgatattaaaaatgca
ggcgctgatgctgtgcttgtagttgatgctcctcatgaactaaaagaagaaaatatttta
agagaatgtctaaataaaaatgaattatcattaattaaacttgttgcaccaacaactgat
gatcaaagactaaaagacattattaaagtttcttcaggttttttatatcaagtgactgta
acgggtacgactggccaaaagtctgctgatgaaaatacagttaaaaatttcattgataaa
atcaaaaatatttcaaatatcccagtttgtactggatttggaattaaaactcctgaagac
gcaaaaaaaatggctaacactgggccatctggagttattgtaggatctgcgtttgtgaaa
tatattcaagataatctggatgacaaagaattgcctcaaaatttgggcaaatacattaag
agttttgtaaaggaattataa

DBGET integrated database retrieval system