KEGG   Alpha proteobacterium HIMB5: HIMB5_00011730Help
Entry
HIMB5_00011730    CDS       T02250                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB5_00011730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB5_00011730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB5_00011730
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIMB5_00011730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1085001..1085801
Genome map
AA seq 266 aa AA seqDB search
MSNRLKKIFQSLKPKTKLVSYFVGCYPNPEISFDLIKQAIDNGVSVLEIGYCTSEASAEG
PIIKKAHDDVLHNNYTLKDTIELVKKIRNYNSEVGIVLMGYIANLYKYPIPNFVTDIKNA
GADAVLVVDAPHELKEENILRECLNKNELSLIKLVAPTTDDQRLKDIIKVSSGFLYQVTV
TGTTGQKSADENTVKNFIDKIKNISNIPVCTGFGIKTPEDAKKMANTGPSGVIVGSAFVK
YIQDNLDDKELPQNLGKYIKSFVKEL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaacagactaaaaaaaatatttcaatctttgaagccaaaaacaaaattggtaagt
tattttgttggttgttatcctaacccagaaataagttttgatcttataaaacaagccata
gacaatggtgtttcagttcttgaaattggctactgcacatctgaagcatctgcagaaggg
ccaattataaaaaaggcacatgatgatgttttgcataataattacactttaaaagacaca
atagaattagttaaaaaaataagaaattataattctgaagttggtattgtattaatgggg
tatatagcaaatttatacaagtaccctattccaaactttgtaactgatattaaaaatgca
ggcgctgatgctgtgcttgtagttgatgctcctcatgaactaaaagaagaaaatatttta
agagaatgtctaaataaaaatgaattatcattaattaaacttgttgcaccaacaactgat
gatcaaagactaaaagacattattaaagtttcttcaggttttttatatcaagtgactgta
acgggtacgactggccaaaagtctgctgatgaaaatacagttaaaaatttcattgataaa
atcaaaaatatttcaaatatcccagtttgtactggatttggaattaaaactcctgaagac
gcaaaaaaaatggctaacactgggccatctggagttattgtaggatctgcgtttgtgaaa
tatattcaagataatctggatgacaaagaattgcctcaaaatttgggcaaatacattaag
agttttgtaaaggaattataa

DBGET integrated database retrieval system