KEGG   Alpha proteobacterium HIMB5: HIMB5_00012450Help
Entry
HIMB5_00012450    CDS       T02250                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00300  Lysine biosynthesis
apm01100  Metabolic pathways
apm01120  Microbial metabolism in diverse environments
apm01230  Biosynthesis of amino acids
Module
apm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HIMB5_00012450
Enzymes [BR:apm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HIMB5_00012450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Aida_N
Motif
Other DBs
NCBI-ProteinID: AFS47986
UniProt: J9YYG3
Position
1137188..1138342
Genome map
AA seq 384 aa AA seqDB search
MQKINELQLAKELIRFPSITPVDAGVMGHLEKKLKSLGFKTKILTFSEKNTKPVKNLYAR
LGNKNPNLCFAGHLDVVPPGNIKDWTINPFKPALKKGHLIGRGANDMKSSIAAFISAVSK
FISNNKFNGSISLLITGDEEGIAVNGTKKVVDYLRKKKEKINFCIVGEPTNPNKLGEMIK
IGRRGSMNGKLTIHGIQGHVAYPHRAKNPITSLIKILNEFKDIKFDKGTKDFQPSNLEIT
KMNINNNADNVIPAAASATFNIRFNNKHSSSSIKNKLNKIIKKIASKNKVKFEINYRVSG
EAFLSKPNATTYMIRDVVKKVTKVNPKLSTTGGTSDARFIRKISPCLEFGLVGKTMHKVD
EAVSISDLKRLTEIYQKILKNYFN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcaatgaactgcagttagccaaagagctaataagatttccatctattaca
cccgtcgatgcaggcgtcatgggtcatttagaaaaaaaattaaaatcacttggttttaaa
actaagattttaactttctctgaaaaaaatacaaagccggtaaaaaatttatacgcaaga
cttgggaacaaaaatccaaacctttgttttgctggtcatttagatgtggtgccgccagga
aatattaaagactggacaattaatccttttaaaccagcgttaaaaaaaggacatttaatt
ggtagaggtgcaaatgatatgaagagctcaattgcagcgtttatttctgctgtcagtaaa
tttatctcaaataataaatttaatggatctatcagcttgttaattacgggtgatgaagaa
ggtattgcagtaaatggtacaaaaaaagttgttgattatttgagaaagaaaaaagaaaaa
ataaatttttgtatagttggtgaacctactaatccaaataaattaggagaaatgattaaa
attggaagacgtggtagcatgaatggcaaacttactattcatggcatacaaggtcatgtt
gcttatccacatagagcaaaaaatcctattacttcgttaataaaaattttaaatgaattt
aaagatattaaatttgataaaggaacgaaagattttcaaccttctaatttagaaattaca
aaaatgaatataaataataatgctgataatgtaattcctgcggcagcatcagctacgttt
aatatcagatttaacaacaaacattcatctagttctattaaaaataaattaaataaaatt
ataaaaaaaatcgcttcaaaaaataaggtgaaatttgaaataaattatagagtttcaggt
gaggctttcttgtcaaaaccaaatgctacaacttatatgattagagatgttgtaaaaaaa
gtaactaaagtgaatccaaaattgtctactactggcggaacatcagatgcaagatttatt
agaaaaataagtccctgtcttgaatttggattagtaggcaaaacaatgcataaagtagac
gaggcagtatcgataagcgacttgaaaagacttacagaaatctaccaaaaaattcttaag
aattatttcaattga

DBGET integrated database retrieval system