KEGG   Alpha proteobacterium HIMB5: HIMB5_00012450Help
Entry
HIMB5_00012450    CDS       T02250                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137188..1138342
Genome map
AA seq 384 aa AA seqDB search
MQKINELQLAKELIRFPSITPVDAGVMGHLEKKLKSLGFKTKILTFSEKNTKPVKNLYAR
LGNKNPNLCFAGHLDVVPPGNIKDWTINPFKPALKKGHLIGRGANDMKSSIAAFISAVSK
FISNNKFNGSISLLITGDEEGIAVNGTKKVVDYLRKKKEKINFCIVGEPTNPNKLGEMIK
IGRRGSMNGKLTIHGIQGHVAYPHRAKNPITSLIKILNEFKDIKFDKGTKDFQPSNLEIT
KMNINNNADNVIPAAASATFNIRFNNKHSSSSIKNKLNKIIKKIASKNKVKFEINYRVSG
EAFLSKPNATTYMIRDVVKKVTKVNPKLSTTGGTSDARFIRKISPCLEFGLVGKTMHKVD
EAVSISDLKRLTEIYQKILKNYFN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcaatgaactgcagttagccaaagagctaataagatttccatctattaca
cccgtcgatgcaggcgtcatgggtcatttagaaaaaaaattaaaatcacttggttttaaa
actaagattttaactttctctgaaaaaaatacaaagccggtaaaaaatttatacgcaaga
cttgggaacaaaaatccaaacctttgttttgctggtcatttagatgtggtgccgccagga
aatattaaagactggacaattaatccttttaaaccagcgttaaaaaaaggacatttaatt
ggtagaggtgcaaatgatatgaagagctcaattgcagcgtttatttctgctgtcagtaaa
tttatctcaaataataaatttaatggatctatcagcttgttaattacgggtgatgaagaa
ggtattgcagtaaatggtacaaaaaaagttgttgattatttgagaaagaaaaaagaaaaa
ataaatttttgtatagttggtgaacctactaatccaaataaattaggagaaatgattaaa
attggaagacgtggtagcatgaatggcaaacttactattcatggcatacaaggtcatgtt
gcttatccacatagagcaaaaaatcctattacttcgttaataaaaattttaaatgaattt
aaagatattaaatttgataaaggaacgaaagattttcaaccttctaatttagaaattaca
aaaatgaatataaataataatgctgataatgtaattcctgcggcagcatcagctacgttt
aatatcagatttaacaacaaacattcatctagttctattaaaaataaattaaataaaatt
ataaaaaaaatcgcttcaaaaaataaggtgaaatttgaaataaattatagagtttcaggt
gaggctttcttgtcaaaaccaaatgctacaacttatatgattagagatgttgtaaaaaaa
gtaactaaagtgaatccaaaattgtctactactggcggaacatcagatgcaagatttatt
agaaaaataagtccctgtcttgaatttggattagtaggcaaaacaatgcataaagtagac
gaggcagtatcgataagcgacttgaaaagacttacagaaatctaccaaaaaattcttaag
aattatttcaattga

DBGET integrated database retrieval system