KEGG   Alpha proteobacterium HIMB5: HIMB5_00012840Help
Entry
HIMB5_00012840    CDS       T02250                                 

Definition
Biotin-requiring, e3 domain-containing 2-oxoacid dehydrogenase with acyltransferase acitivity family protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00012840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00012840
   00020 Citrate cycle (TCA cycle)
    HIMB5_00012840
   00620 Pyruvate metabolism
    HIMB5_00012840
Enzymes [BR:apm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HIMB5_00012840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1177424..1178683)
Genome map
AA seq 419 aa AA seqDB search
MSQTEIKVPNIGDFKDVEVIEVLVKEGDEVKKNDPLITIESDKSSVEIPSTVDGKIIKLN
LKIGDKVSEGDNILQIEINTKSNEKPSKNIEVKKEEKGSQKQIKEIQPSSVVEINTEGGF
ALASPKTRKFARELGVNINLIKGSQLKGRVDETDIKNFISSGNNSLHYEDKKNKKLELEF
QHDEFGSIEVKDIPRVKKLASTYLSNSWSNIPHVTNHDEADITELENFRSSLTDIYTGEK
KKITPLAFIVKALTASLKKFPSFNSSIDEIEDGKMTLKKYFHIGIAVDTKHGLMVPKLRN
ANNKSISNIAAELKNLSELCKNLKIDKKELFGGSMTITSLGGIGGSFFTPIINYPEVAIL
GIGKAEKKQKFINGKFETRTILPISLSYDHRIIDGAEAARFNNDLKENLGKNFAYKLAV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaactgaaataaaagttccaaacataggagattttaaagatgtggaggtaata
gaagttttagttaaagaaggtgatgaagttaaaaaaaatgatccgctaataacaattgaa
agtgataaatctagtgttgaaattcctagcacggtagatggtaaaattattaagcttaat
ttaaaaattggtgacaaagtttcagaaggagacaatattttacaaattgaaataaatact
aaatctaatgaaaaaccatcaaaaaatattgaagtaaaaaaagaggaaaaaggaagtcaa
aaacaaatcaaagaaatacaaccaagttcggtagtagaaataaatacagagggaggattt
gctttagcatcaccaaaaactcgaaagtttgcgagagaattaggcgttaatattaattta
attaaaggcagtcaactaaaaggaagagtagatgaaactgatataaagaattttatttca
tcaggaaataatagtttacattatgaagataaaaaaaataaaaaattagaattagaattt
caacatgatgagtttgggtctattgaggtaaaagatattcctcgggtaaaaaaattagca
tctacttacctttcaaactcttggtctaatattcctcatgtaacaaatcatgatgaagct
gacataactgaactagaaaattttcgatcatcattgactgacatttatactggagaaaaa
aaaaagataactccattagcgtttattgttaaagccctaactgcatcattaaaaaaattt
cctagttttaattcttcaattgatgaaattgaagatggaaaaatgacattaaaaaaatat
tttcatataggtattgctgttgatactaagcatggtttgatggtgcctaaattaagaaat
gcaaataataaaagtatatctaatatagctgctgagctaaaaaatttgagtgaattatgt
aaaaatcttaaaattgataaaaaagaattatttggtggatctatgaccattacaagctta
ggaggtataggtggttcattttttactcctattattaattacccagaagttgccatttta
gggattggtaaagcagaaaagaagcagaaatttataaatggaaagtttgaaactagaaca
attctaccaatttcactatcatatgatcacagaataattgatggtgctgaagcagcaaga
tttaataatgatttaaaagaaaatcttggcaaaaattttgcgtataaacttgctgtttaa

DBGET integrated database retrieval system