KEGG   Alpha proteobacterium HIMB5: HIMB5_00012840Help
Entry
HIMB5_00012840    CDS       T02250                                 

Definition
(GenBank) Biotin-requiring, e3 domain-containing 2-oxoacid dehydrogenase with acyltransferase acitivity family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00010  Glycolysis / Gluconeogenesis
apm00020  Citrate cycle (TCA cycle)
apm00620  Pyruvate metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01130  Biosynthesis of antibiotics
apm01200  Carbon metabolism
Module
apm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00012840
   00020 Citrate cycle (TCA cycle)
    HIMB5_00012840
   00620 Pyruvate metabolism
    HIMB5_00012840
Enzymes [BR:apm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HIMB5_00012840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H PYNP_C PTS_EIIA_1 HlyD_D23 Crystall_2 NQRA HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFS48024
UniProt: J9YWB6
Position
complement(1177424..1178683)
Genome map
AA seq 419 aa AA seqDB search
MSQTEIKVPNIGDFKDVEVIEVLVKEGDEVKKNDPLITIESDKSSVEIPSTVDGKIIKLN
LKIGDKVSEGDNILQIEINTKSNEKPSKNIEVKKEEKGSQKQIKEIQPSSVVEINTEGGF
ALASPKTRKFARELGVNINLIKGSQLKGRVDETDIKNFISSGNNSLHYEDKKNKKLELEF
QHDEFGSIEVKDIPRVKKLASTYLSNSWSNIPHVTNHDEADITELENFRSSLTDIYTGEK
KKITPLAFIVKALTASLKKFPSFNSSIDEIEDGKMTLKKYFHIGIAVDTKHGLMVPKLRN
ANNKSISNIAAELKNLSELCKNLKIDKKELFGGSMTITSLGGIGGSFFTPIINYPEVAIL
GIGKAEKKQKFINGKFETRTILPISLSYDHRIIDGAEAARFNNDLKENLGKNFAYKLAV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaactgaaataaaagttccaaacataggagattttaaagatgtggaggtaata
gaagttttagttaaagaaggtgatgaagttaaaaaaaatgatccgctaataacaattgaa
agtgataaatctagtgttgaaattcctagcacggtagatggtaaaattattaagcttaat
ttaaaaattggtgacaaagtttcagaaggagacaatattttacaaattgaaataaatact
aaatctaatgaaaaaccatcaaaaaatattgaagtaaaaaaagaggaaaaaggaagtcaa
aaacaaatcaaagaaatacaaccaagttcggtagtagaaataaatacagagggaggattt
gctttagcatcaccaaaaactcgaaagtttgcgagagaattaggcgttaatattaattta
attaaaggcagtcaactaaaaggaagagtagatgaaactgatataaagaattttatttca
tcaggaaataatagtttacattatgaagataaaaaaaataaaaaattagaattagaattt
caacatgatgagtttgggtctattgaggtaaaagatattcctcgggtaaaaaaattagca
tctacttacctttcaaactcttggtctaatattcctcatgtaacaaatcatgatgaagct
gacataactgaactagaaaattttcgatcatcattgactgacatttatactggagaaaaa
aaaaagataactccattagcgtttattgttaaagccctaactgcatcattaaaaaaattt
cctagttttaattcttcaattgatgaaattgaagatggaaaaatgacattaaaaaaatat
tttcatataggtattgctgttgatactaagcatggtttgatggtgcctaaattaagaaat
gcaaataataaaagtatatctaatatagctgctgagctaaaaaatttgagtgaattatgt
aaaaatcttaaaattgataaaaaagaattatttggtggatctatgaccattacaagctta
ggaggtataggtggttcattttttactcctattattaattacccagaagttgccatttta
gggattggtaaagcagaaaagaagcagaaatttataaatggaaagtttgaaactagaaca
attctaccaatttcactatcatatgatcacagaataattgatggtgctgaagcagcaaga
tttaataatgatttaaaagaaaatcttggcaaaaattttgcgtataaacttgctgtttaa

DBGET integrated database retrieval system